BLASTX nr result
ID: Papaver27_contig00053819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00053819 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB92316.1| hypothetical protein L484_004636 [Morus notabilis] 58 1e-06 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 57 3e-06 >gb|EXB92316.1| hypothetical protein L484_004636 [Morus notabilis] Length = 202 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 397 SARVVRCLVKSYNERNPRFVLLRHAPDFQVTF 302 SARVVRCLVKSYNERNPRFVLLRHAP V F Sbjct: 78 SARVVRCLVKSYNERNPRFVLLRHAPKEMVGF 109 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 397 SARVVRCLVKSYNERNPRFVLLRHAPDFQV 308 SARVVRCLVKSYNERNPRFVLLRHAP +V Sbjct: 322 SARVVRCLVKSYNERNPRFVLLRHAPKEKV 351