BLASTX nr result
ID: Papaver27_contig00053789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00053789 (550 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322974.2| hypothetical protein POPTR_0016s12180g [Popu... 37 2e-06 >ref|XP_002322974.2| hypothetical protein POPTR_0016s12180g [Populus trichocarpa] gi|550321328|gb|EEF04735.2| hypothetical protein POPTR_0016s12180g [Populus trichocarpa] Length = 500 Score = 36.6 bits (83), Expect(3) = 2e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 Query: 43 ELDLPINKSFRIKFILKDPIGKVIWQP 123 E+D+P+ KS + KFILK K+ WQP Sbjct: 145 EMDIPVGKSIQFKFILKGIAEKIFWQP 171 Score = 31.6 bits (70), Expect(3) = 2e-06 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 129 WNTVGLHLITEEEPLADSNTKEPIAHPISSVVEISQPEEEQNVAGD 266 W L ITEEEP A + ++EP+ +P S +V + +++ V D Sbjct: 192 WEDAALQKITEEEPSA-NGSEEPVVNPESLIVAENLTCQKEEVVSD 236 Score = 28.5 bits (62), Expect(3) = 2e-06 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 5 IPLKWSKGHFWTLNL 49 IPL WS GH WT+ + Sbjct: 132 IPLNWSDGHLWTVEM 146