BLASTX nr result
ID: Papaver27_contig00053555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00053555 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270898.2| PREDICTED: uncharacterized protein At4g22758... 57 2e-06 >ref|XP_002270898.2| PREDICTED: uncharacterized protein At4g22758-like [Vitis vinifera] Length = 248 Score = 57.4 bits (137), Expect = 2e-06 Identities = 38/105 (36%), Positives = 49/105 (46%), Gaps = 5/105 (4%) Frame = +2 Query: 179 MTERKSKQRVSSARQKAKLPVPXXXXXXXXNCRRRKPAATPRLSKPPPKPTGILHRCKSE 358 M+ER ++R+ S R++ + P P + T R K P KP +LHRC SE Sbjct: 1 MSERSFRRRIPSIRRRTRPPHPPPSP--------HRRTLTHRRLKKPSKPVAVLHRCSSE 52 Query: 359 PNFWNVGIAF----GNGITSYPEMHRPLTCTDVLA-SPFTSSLNS 478 P W V + S + RP TCTDVLA S F SS S Sbjct: 53 PILWTVSFFVDGDDNRNLESDGVLFRPQTCTDVLATSSFCSSFLS 97