BLASTX nr result
ID: Papaver27_contig00053168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00053168 (556 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141345.1| hypothetical protein PHAVU_008G187800g [Phas... 62 8e-08 ref|XP_004516254.1| PREDICTED: autophagy-related protein 13-like... 62 1e-07 ref|XP_003615489.1| Autophagy-related protein [Medicago truncatu... 62 1e-07 ref|XP_006347547.1| PREDICTED: autophagy-related protein 13-like... 60 3e-07 ref|XP_007220540.1| hypothetical protein PRUPE_ppa002889mg [Prun... 60 4e-07 ref|XP_004235269.1| PREDICTED: uncharacterized protein LOC101244... 60 4e-07 ref|XP_002317854.2| hypothetical protein POPTR_0012s00380g [Popu... 59 8e-07 ref|XP_002317700.2| hypothetical protein POPTR_0012s00300g [Popu... 59 8e-07 ref|XP_002317853.2| hypothetical protein POPTR_0012s00300g [Popu... 59 8e-07 ref|XP_004307894.1| PREDICTED: uncharacterized protein LOC101306... 59 8e-07 ref|XP_002515663.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 ref|XP_002321937.1| hypothetical protein POPTR_0015s00270g [Popu... 58 2e-06 ref|XP_003519222.1| PREDICTED: autophagy-related protein 13-like... 57 2e-06 dbj|BAM64847.1| hypothetical protein [Beta vulgaris] 57 4e-06 >ref|XP_007141345.1| hypothetical protein PHAVU_008G187800g [Phaseolus vulgaris] gi|561014478|gb|ESW13339.1| hypothetical protein PHAVU_008G187800g [Phaseolus vulgaris] Length = 593 Score = 62.4 bits (150), Expect = 8e-08 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 EFDG V TA SGFF+ RKT+DALEELR YR+M+DLLLS+SG R Sbjct: 545 EFDGGVATA-SGFFMPRKTADALEELRGYREMRDLLLSKSGTR 586 >ref|XP_004516254.1| PREDICTED: autophagy-related protein 13-like [Cicer arietinum] Length = 586 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E DG V TA SGFF+ RKT+DALEELRSYR+M+DLLLS+SG R Sbjct: 541 ELDGGVATA-SGFFMPRKTTDALEELRSYREMRDLLLSKSGTR 582 >ref|XP_003615489.1| Autophagy-related protein [Medicago truncatula] gi|355516824|gb|AES98447.1| Autophagy-related protein [Medicago truncatula] Length = 584 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E DG V TA SGFF+ RKT+DALEELRSYR+M+DLLLS+SG R Sbjct: 536 ELDGGVATA-SGFFMPRKTTDALEELRSYREMRDLLLSKSGTR 577 >ref|XP_006347547.1| PREDICTED: autophagy-related protein 13-like isoform X1 [Solanum tuberosum] gi|565361609|ref|XP_006347548.1| PREDICTED: autophagy-related protein 13-like isoform X2 [Solanum tuberosum] Length = 604 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/47 (61%), Positives = 40/47 (85%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNRDSAD 413 E DGE++TA SGFF+ RK+SDALEEL++Y+D+KDLLLS+S R ++ Sbjct: 558 ELDGELSTA-SGFFISRKSSDALEELKTYKDLKDLLLSKSATRSVSE 603 >ref|XP_007220540.1| hypothetical protein PRUPE_ppa002889mg [Prunus persica] gi|462417002|gb|EMJ21739.1| hypothetical protein PRUPE_ppa002889mg [Prunus persica] Length = 624 Score = 60.1 bits (144), Expect = 4e-07 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E +G V TA SGFF+ RKTSDALEELRSY++MKDLLLS+SG R Sbjct: 576 EHEGGVATA-SGFFMPRKTSDALEELRSYKEMKDLLLSKSGMR 617 >ref|XP_004235269.1| PREDICTED: uncharacterized protein LOC101244264 [Solanum lycopersicum] Length = 604 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/47 (61%), Positives = 39/47 (82%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNRDSAD 413 E DGE++TA SGFF+ RK SDALEEL++Y+D+KDLLLS+S R ++ Sbjct: 558 ELDGELSTA-SGFFISRKASDALEELKTYKDLKDLLLSKSATRSVSE 603 >ref|XP_002317854.2| hypothetical protein POPTR_0012s00380g [Populus trichocarpa] gi|550326062|gb|EEE96074.2| hypothetical protein POPTR_0012s00380g [Populus trichocarpa] Length = 619 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 541 EVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E + ASGFF+ RKT+DALEELRSYR+MKDLLLS+SG R Sbjct: 574 EGMSTASGFFLPRKTADALEELRSYREMKDLLLSKSGTR 612 >ref|XP_002317700.2| hypothetical protein POPTR_0012s00300g [Populus trichocarpa] gi|550326056|gb|EEE95920.2| hypothetical protein POPTR_0012s00300g [Populus trichocarpa] Length = 543 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 541 EVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E + ASGFF+ RKT+DALEELRSYR+MKDLLLS+SG R Sbjct: 498 EGMSTASGFFLPRKTADALEELRSYREMKDLLLSKSGTR 536 >ref|XP_002317853.2| hypothetical protein POPTR_0012s00300g [Populus trichocarpa] gi|550326055|gb|EEE96073.2| hypothetical protein POPTR_0012s00300g [Populus trichocarpa] Length = 619 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 541 EVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E + ASGFF+ RKT+DALEELRSYR+MKDLLLS+SG R Sbjct: 574 EGMSTASGFFLPRKTADALEELRSYREMKDLLLSKSGTR 612 >ref|XP_004307894.1| PREDICTED: uncharacterized protein LOC101306759 [Fragaria vesca subsp. vesca] Length = 615 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 541 EVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E + ASGFF+ RKTSDALEELRSYR+MKDLL+S+SG R Sbjct: 570 EGVSTASGFFMPRKTSDALEELRSYREMKDLLISKSGMR 608 >ref|XP_002515663.1| conserved hypothetical protein [Ricinus communis] gi|223545206|gb|EEF46715.1| conserved hypothetical protein [Ricinus communis] Length = 621 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 541 EVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E ASGFF+ RKT+DALEELRSYR+MKDLLLS+SG R Sbjct: 576 EGVATASGFFLPRKTADALEELRSYREMKDLLLSKSGTR 614 >ref|XP_002321937.1| hypothetical protein POPTR_0015s00270g [Populus trichocarpa] gi|222868933|gb|EEF06064.1| hypothetical protein POPTR_0015s00270g [Populus trichocarpa] Length = 603 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 526 ASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 ASGFF+ RKT DALEELRSYR+MKDLLLS+SG R Sbjct: 563 ASGFFMPRKTGDALEELRSYREMKDLLLSKSGTR 596 >ref|XP_003519222.1| PREDICTED: autophagy-related protein 13-like [Glycine max] Length = 594 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 553 EFDGEVTTAASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 E +G V TA SGFF+ RKT+DALEELR Y++M+DLLLS+SG R Sbjct: 546 ELEGGVATA-SGFFMPRKTADALEELRGYKEMRDLLLSKSGTR 587 >dbj|BAM64847.1| hypothetical protein [Beta vulgaris] Length = 891 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -1 Query: 526 ASGFFVLRKTSDALEELRSYRDMKDLLLSQSGNR 425 ASGFF+ R+ SDALEEL+SYR+MK+LLLS+SGNR Sbjct: 839 ASGFFMTRRASDALEELKSYREMKELLLSKSGNR 872