BLASTX nr result
ID: Papaver27_contig00052860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00052860 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482933.1| PREDICTED: F-box/WD-40 repeat-containing pro... 63 5e-08 ref|XP_006438944.1| hypothetical protein CICLE_v10031605mg [Citr... 63 5e-08 ref|XP_006438943.1| hypothetical protein CICLE_v10031605mg [Citr... 63 5e-08 ref|XP_006438942.1| hypothetical protein CICLE_v10031605mg [Citr... 63 5e-08 gb|EXB95302.1| F-box/WD-40 repeat-containing protein [Morus nota... 60 2e-07 ref|XP_002271688.2| PREDICTED: F-box/WD-40 repeat-containing pro... 60 2e-07 emb|CBI24978.3| unnamed protein product [Vitis vinifera] 60 2e-07 emb|CAN61154.1| hypothetical protein VITISV_013775 [Vitis vinifera] 60 2e-07 ref|XP_004303116.1| PREDICTED: F-box/WD-40 repeat-containing pro... 59 9e-07 ref|XP_007218033.1| hypothetical protein PRUPE_ppa006005mg [Prun... 59 9e-07 ref|XP_002517753.1| F-box and wd40 domain protein, putative [Ric... 58 1e-06 ref|XP_003599502.1| F-box/WD-40 repeat-containing protein [Medic... 58 2e-06 ref|XP_002314059.2| F-box family protein [Populus trichocarpa] g... 57 2e-06 ref|XP_007052463.1| F-box family protein with WD40/YVTN repeat d... 56 6e-06 ref|XP_007052462.1| F-box family protein with WD40/YVTN repeat d... 56 6e-06 ref|XP_007052461.1| F-box family protein with WD40/YVTN repeat d... 56 6e-06 ref|XP_006591036.1| PREDICTED: F-box/WD-40 repeat-containing pro... 55 8e-06 ref|XP_003538059.1| PREDICTED: F-box/WD-40 repeat-containing pro... 55 8e-06 >ref|XP_006482933.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like isoform X2 [Citrus sinensis] Length = 320 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGMKKVVTTHN+K+IRLW+F Sbjct: 282 PKTKRPPITCLAVGMKKVVTTHNSKYIRLWKF 313 >ref|XP_006438944.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|557541140|gb|ESR52184.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 425 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGMKKVVTTHN+K+IRLW+F Sbjct: 387 PKTKRPPITCLAVGMKKVVTTHNSKYIRLWKF 418 >ref|XP_006438943.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|568858801|ref|XP_006482932.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like isoform X1 [Citrus sinensis] gi|557541139|gb|ESR52183.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 430 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGMKKVVTTHN+K+IRLW+F Sbjct: 392 PKTKRPPITCLAVGMKKVVTTHNSKYIRLWKF 423 >ref|XP_006438942.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|557541138|gb|ESR52182.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 311 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGMKKVVTTHN+K+IRLW+F Sbjct: 273 PKTKRPPITCLAVGMKKVVTTHNSKYIRLWKF 304 >gb|EXB95302.1| F-box/WD-40 repeat-containing protein [Morus notabilis] Length = 424 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRFQ 348 P+ RPP+TCLAVGMKK+VTTHN+K+IR+W+F+ Sbjct: 391 PRSDRPPITCLAVGMKKIVTTHNSKYIRMWKFR 423 >ref|XP_002271688.2| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like [Vitis vinifera] Length = 421 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGM+KVVTTHN K+IR+W+F Sbjct: 382 PKSSRPPITCLAVGMQKVVTTHNGKYIRMWKF 413 >emb|CBI24978.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGM+KVVTTHN K+IR+W+F Sbjct: 396 PKSSRPPITCLAVGMQKVVTTHNGKYIRMWKF 427 >emb|CAN61154.1| hypothetical protein VITISV_013775 [Vitis vinifera] Length = 471 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK RPP+TCLAVGM+KVVTTHN K+IR+W+F Sbjct: 432 PKSSRPPITCLAVGMQKVVTTHNGKYIRMWKF 463 >ref|XP_004303116.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like [Fragaria vesca subsp. vesca] Length = 437 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 P+ RPP+TCLAV MKKV+TTHNNK+IR W+F Sbjct: 405 PRSSRPPITCLAVWMKKVITTHNNKYIRTWKF 436 >ref|XP_007218033.1| hypothetical protein PRUPE_ppa006005mg [Prunus persica] gi|462414495|gb|EMJ19232.1| hypothetical protein PRUPE_ppa006005mg [Prunus persica] Length = 433 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -3 Query: 443 KDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 + RPP+TCLAVGMKKV+TTHN+K+IR+W+F Sbjct: 400 RSCRPPITCLAVGMKKVITTHNSKYIRIWKF 430 >ref|XP_002517753.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223543025|gb|EEF44560.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 336 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRFQ 348 P+ RP +TCLAVGMKKVVTTHN+K+IR+W+F+ Sbjct: 303 PRSSRPSITCLAVGMKKVVTTHNSKYIRVWKFK 335 >ref|XP_003599502.1| F-box/WD-40 repeat-containing protein [Medicago truncatula] gi|355488550|gb|AES69753.1| F-box/WD-40 repeat-containing protein [Medicago truncatula] Length = 438 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRFQ*SGVVTL 327 P++ RP +TCLAVGMKKVVTTHN + IRLW+F+ + ++L Sbjct: 399 PRNSRPSITCLAVGMKKVVTTHNTRDIRLWKFKDNNTISL 438 >ref|XP_002314059.2| F-box family protein [Populus trichocarpa] gi|550331137|gb|EEE88014.2| F-box family protein [Populus trichocarpa] Length = 444 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 PK +RPP+TCLAVGM+KV+TTHN K IR+W+F Sbjct: 406 PKTVRPPITCLAVGMQKVITTHNIKNIRMWKF 437 >ref|XP_007052463.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 3 [Theobroma cacao] gi|508704724|gb|EOX96620.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 3 [Theobroma cacao] Length = 363 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 P+ RPP+TCLAVGMKKVVT HN +IR+W+F Sbjct: 330 PRTARPPITCLAVGMKKVVTAHNINYIRMWKF 361 >ref|XP_007052462.1| F-box family protein with WD40/YVTN repeat doamin isoform 2 [Theobroma cacao] gi|508704723|gb|EOX96619.1| F-box family protein with WD40/YVTN repeat doamin isoform 2 [Theobroma cacao] Length = 305 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 P+ RPP+TCLAVGMKKVVT HN +IR+W+F Sbjct: 272 PRTARPPITCLAVGMKKVVTAHNINYIRMWKF 303 >ref|XP_007052461.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 1 [Theobroma cacao] gi|508704722|gb|EOX96618.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 1 [Theobroma cacao] Length = 432 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRF 351 P+ RPP+TCLAVGMKKVVT HN +IR+W+F Sbjct: 399 PRTARPPITCLAVGMKKVVTAHNINYIRMWKF 430 >ref|XP_006591036.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030 isoform X2 [Glycine max] Length = 411 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRFQ 348 PK RP +TCLAVGMKK+VTTHN IRLW+F+ Sbjct: 374 PKTARPSITCLAVGMKKIVTTHNTNDIRLWKFK 406 >ref|XP_003538059.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030 isoform X1 [Glycine max] Length = 444 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 446 PKDLRPPVTCLAVGMKKVVTTHNNKFIRLWRFQ 348 PK RP +TCLAVGMKK+VTTHN IRLW+F+ Sbjct: 407 PKTARPSITCLAVGMKKIVTTHNTNDIRLWKFK 439