BLASTX nr result
ID: Papaver27_contig00052468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00052468 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280252.2| PREDICTED: GTPase-activating protein gyp7-li... 45 8e-07 >ref|XP_002280252.2| PREDICTED: GTPase-activating protein gyp7-like isoform 3 [Vitis vinifera] Length = 591 Score = 45.1 bits (105), Expect(2) = 8e-07 Identities = 28/61 (45%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = -1 Query: 435 IVAITGLVLVALCTLIHSLRGHLRSPWS*RIRKQPFRLNGGKSI*-PRWKLCDGEVKFLK 259 + A+ GL L A T++++ RG L+SPWS R RK KS+ P K DG VKFLK Sbjct: 77 VTAMAGLALAA--TVVYTRRGTLKSPWSRRRRKHALLAKQWKSLFTPDGKFTDGGVKFLK 134 Query: 258 K 256 K Sbjct: 135 K 135 Score = 33.5 bits (75), Expect(2) = 8e-07 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 18/47 (38%) Frame = -3 Query: 253 GIAPQIRAELWPFVLEV------------------KQFEKSRKQCKR 167 G+ P IR E+WPF+L V K++E RKQC+R Sbjct: 140 GVDPSIRVEVWPFLLGVYDVKSSREERDSIRAQKRKEYENLRKQCRR 186