BLASTX nr result
ID: Papaver27_contig00052290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00052290 (704 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW76830.1| hypothetical protein ZEAMMB73_573219 [Zea mays] 59 2e-06 >gb|AFW76830.1| hypothetical protein ZEAMMB73_573219 [Zea mays] Length = 252 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 2 GKLCLEYLRNLSIDDAKKELRGYKGIGPKTVCAVFISDF 118 GK+CLEYLR LS+D+ KKEL +KGIGPKTV ++ +S F Sbjct: 211 GKICLEYLRELSVDEVKKELSRFKGIGPKTVSSISLSSF 249