BLASTX nr result
ID: Papaver27_contig00051714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00051714 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN09876.1| NdhF, partial (chloroplast) [Papaver lateritium] 97 2e-18 gb|AFN09907.1| NdhF, partial (chloroplast) [Papaver sp. WX-2012] 97 3e-18 gb|AFN09888.1| NdhF, partial (chloroplast) [Meconopsis horridula] 95 1e-17 gb|AFN09864.1| NdhF, partial (chloroplast) [Meconopsis horridula... 95 1e-17 gb|AFN09858.1| NdhF, partial (chloroplast) [Meconopsis horridula... 95 1e-17 gb|AFN09853.1| NdhF, partial (chloroplast) [Meconopsis horridula] 95 1e-17 gb|AFN09849.1| NdhF, partial (chloroplast) [Meconopsis horridula] 95 1e-17 gb|AFN09898.1| NdhF, partial (chloroplast) [Meconopsis cambrica] 94 2e-17 gb|AFN09896.1| NdhF, partial (chloroplast) [Meconopsis horridula] 94 2e-17 gb|AFN09905.1| NdhF, partial (chloroplast) [Meconopsis simplicif... 94 3e-17 gb|AFN09895.1| NdhF, partial (chloroplast) [Meconopsis grandis] 94 3e-17 gb|AFN09869.1| NdhF, partial (chloroplast) [Meconopsis betonicif... 94 3e-17 gb|AFN09867.1| NdhF, partial (chloroplast) [Meconopsis integrifo... 94 3e-17 gb|AFN09866.1| NdhF, partial (chloroplast) [Meconopsis simplicif... 94 3e-17 gb|AFN09899.1| NdhF, partial (chloroplast) [Papaver alpinum] 93 4e-17 gb|AHG99154.1| NADH dehydrogenase subunit F, partial (chloroplas... 92 1e-16 gb|AFN09914.1| NdhF, partial (chloroplast) [Meconopsis superba] 92 1e-16 gb|AFN09902.1| NdhF, partial (chloroplast) [Meconopsis florindae] 92 1e-16 gb|AFN09892.1| NdhF, partial (chloroplast) [Meconopsis speciosa] 92 1e-16 gb|AFN09886.1| NdhF, partial (chloroplast) [Meconopsis bella] 92 1e-16 >gb|AFN09876.1| NdhF, partial (chloroplast) [Papaver lateritium] Length = 548 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHFKNKE NPYPYESENTMLFPLLILGF+TLCVGFIGIPFDY+ Sbjct: 436 ITFTHFKNKENNPYPYESENTMLFPLLILGFITLCVGFIGIPFDYR 481 >gb|AFN09907.1| NdhF, partial (chloroplast) [Papaver sp. WX-2012] Length = 548 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIGIPFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYR 481 >gb|AFN09888.1| NdhF, partial (chloroplast) [Meconopsis horridula] Length = 548 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09864.1| NdhF, partial (chloroplast) [Meconopsis horridula] gi|393661083|gb|AFN09889.1| NdhF, partial (chloroplast) [Meconopsis horridula] gi|393661123|gb|AFN09909.1| NdhF, partial (chloroplast) [Meconopsis horridula] Length = 548 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09858.1| NdhF, partial (chloroplast) [Meconopsis horridula] gi|393661055|gb|AFN09875.1| NdhF, partial (chloroplast) [Meconopsis horridula] gi|393661065|gb|AFN09880.1| NdhF, partial (chloroplast) [Meconopsis horridula] Length = 548 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09853.1| NdhF, partial (chloroplast) [Meconopsis horridula] Length = 548 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09849.1| NdhF, partial (chloroplast) [Meconopsis horridula] Length = 548 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09898.1| NdhF, partial (chloroplast) [Meconopsis cambrica] Length = 548 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE NPYPYESENTMLFPLLILGF TLCVGF+GIPFDY+ Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFFTLCVGFLGIPFDYR 481 >gb|AFN09896.1| NdhF, partial (chloroplast) [Meconopsis horridula] Length = 548 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDY 437 +TFTHF+NKE NPYPYESENTMLFPLLILGFVTLCVGFIG PFDY Sbjct: 436 ITFTHFRNKENNPYPYESENTMLFPLLILGFVTLCVGFIGTPFDY 480 >gb|AFN09905.1| NdhF, partial (chloroplast) [Meconopsis simplicifolia] Length = 543 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIGIPFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYR 481 >gb|AFN09895.1| NdhF, partial (chloroplast) [Meconopsis grandis] Length = 548 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIGIPFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYR 481 >gb|AFN09869.1| NdhF, partial (chloroplast) [Meconopsis betonicifolia] Length = 548 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIGIPFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYR 481 >gb|AFN09867.1| NdhF, partial (chloroplast) [Meconopsis integrifolia] Length = 548 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIGIPFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYR 481 >gb|AFN09866.1| NdhF, partial (chloroplast) [Meconopsis simplicifolia] Length = 548 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIGIPFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYR 481 >gb|AFN09899.1| NdhF, partial (chloroplast) [Papaver alpinum] Length = 548 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE +PYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENSPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AHG99154.1| NADH dehydrogenase subunit F, partial (chloroplast) [Meconopsis robusta] Length = 548 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09914.1| NdhF, partial (chloroplast) [Meconopsis superba] Length = 548 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09902.1| NdhF, partial (chloroplast) [Meconopsis florindae] Length = 268 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 156 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 201 >gb|AFN09892.1| NdhF, partial (chloroplast) [Meconopsis speciosa] Length = 548 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481 >gb|AFN09886.1| NdhF, partial (chloroplast) [Meconopsis bella] Length = 548 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 303 LTFTHFKNKEKNPYPYESENTMLFPLLILGFVTLCVGFIGIPFDYK 440 +TFTHF+NKE PYPYESENTMLFPLLILGFVTLCVGFIG PFDY+ Sbjct: 436 ITFTHFRNKENYPYPYESENTMLFPLLILGFVTLCVGFIGTPFDYR 481