BLASTX nr result
ID: Papaver27_contig00051713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00051713 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372334.1| hypothetical protein POPTR_0017s00650g [Popu... 41 8e-06 >ref|XP_006372334.1| hypothetical protein POPTR_0017s00650g [Populus trichocarpa] gi|550318950|gb|ERP50131.1| hypothetical protein POPTR_0017s00650g [Populus trichocarpa] Length = 302 Score = 41.2 bits (95), Expect(2) = 8e-06 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +1 Query: 109 FYISGCLLTLRPWSNMIESLIVSIRTVPIWVLI*NVPLHM*DNEGLSLISSFIG 270 FY L+PWS + I +++ PIW+ + N+ LH+ E LS I+S +G Sbjct: 99 FYDGSKPFILKPWSRDLSLEIKELKSAPIWIKLPNLRLHLWSPEALSKIASLVG 152 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 273 PLLADDYTLNITRFSFARICI*VDVDFNYPDSISL 377 PL AD T + FAR+C+ VD D PDS+++ Sbjct: 154 PLFADTVTASRETLCFARVCVEVDFDKMLPDSVTI 188