BLASTX nr result
ID: Papaver27_contig00051042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00051042 (1027 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007160811.1| hypothetical protein PHAVU_001G018500g [Phas... 64 1e-07 ref|XP_007160809.1| hypothetical protein PHAVU_001G018500g [Phas... 64 1e-07 ref|XP_006595949.1| PREDICTED: B3 domain-containing protein Os01... 59 3e-06 ref|XP_004978926.1| PREDICTED: B3 domain-containing protein Os11... 58 5e-06 >ref|XP_007160811.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] gi|593795548|ref|XP_007160812.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] gi|561034275|gb|ESW32805.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] gi|561034276|gb|ESW32806.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] Length = 593 Score = 63.5 bits (153), Expect = 1e-07 Identities = 28/71 (39%), Positives = 43/71 (60%) Frame = -3 Query: 215 NVRPVEFFKIFLSPKSFYKMKVRVEFLAQITREIPGIFSLCGPSGKVWRVRLLKMDDGYY 36 N+R F+++F S S +++K+ F+ ++ G SL GPSG VW V+LLK D+ + Sbjct: 10 NLRKPHFYEVFSSAFSSHRLKIPDGFVCRMEGRTYGSLSLIGPSGNVWTVQLLKQDNDLF 69 Query: 35 FEEGWQDFVID 3 F GW FV+D Sbjct: 70 FHHGWSSFVVD 80 >ref|XP_007160809.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] gi|593795544|ref|XP_007160810.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] gi|561034273|gb|ESW32803.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] gi|561034274|gb|ESW32804.1| hypothetical protein PHAVU_001G018500g [Phaseolus vulgaris] Length = 559 Score = 63.5 bits (153), Expect = 1e-07 Identities = 28/71 (39%), Positives = 43/71 (60%) Frame = -3 Query: 215 NVRPVEFFKIFLSPKSFYKMKVRVEFLAQITREIPGIFSLCGPSGKVWRVRLLKMDDGYY 36 N+R F+++F S S +++K+ F+ ++ G SL GPSG VW V+LLK D+ + Sbjct: 10 NLRKPHFYEVFSSAFSSHRLKIPDGFVCRMEGRTYGSLSLIGPSGNVWTVQLLKQDNDLF 69 Query: 35 FEEGWQDFVID 3 F GW FV+D Sbjct: 70 FHHGWSSFVVD 80 >ref|XP_006595949.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Glycine max] Length = 600 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/71 (35%), Positives = 42/71 (59%) Frame = -3 Query: 215 NVRPVEFFKIFLSPKSFYKMKVRVEFLAQITREIPGIFSLCGPSGKVWRVRLLKMDDGYY 36 NVR F++++ S S +++++ F+ + G SL GPSG +W V+L+K D+ + Sbjct: 10 NVRKPHFYEVYSSAFSSHRLRLPDGFVCYMEGRAYGSVSLTGPSGNIWTVQLIKQDNDLF 69 Query: 35 FEEGWQDFVID 3 F GW FV+D Sbjct: 70 FHHGWSTFVVD 80 >ref|XP_004978926.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Setaria italica] Length = 475 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/66 (37%), Positives = 39/66 (59%) Frame = -3 Query: 200 EFFKIFLSPKSFYKMKVRVEFLAQITREIPGIFSLCGPSGKVWRVRLLKMDDGYYFEEGW 21 +FFKIF +S ++K+ F + + G+ SL GPSG W+ L +G +FE+GW Sbjct: 106 QFFKIFFPDQSRERLKIPTAFHQHLKEQPTGLVSLKGPSGNTWQAVLTSDSEGLFFEQGW 165 Query: 20 QDFVID 3 ++FV D Sbjct: 166 KEFVTD 171