BLASTX nr result
ID: Papaver27_contig00050813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00050813 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851707.1| hypothetical protein AMTR_s00040p00207350 [A... 75 1e-11 >ref|XP_006851707.1| hypothetical protein AMTR_s00040p00207350 [Amborella trichopoda] gi|548855287|gb|ERN13174.1| hypothetical protein AMTR_s00040p00207350 [Amborella trichopoda] Length = 387 Score = 75.5 bits (184), Expect = 1e-11 Identities = 44/85 (51%), Positives = 56/85 (65%), Gaps = 13/85 (15%) Frame = -3 Query: 586 ISGDFKE-----DEIDEGKTKEDRDEK-----IGTKRRKSNRNR-MFDVYEDFED--ISP 446 +SGDF + D +E K +E+R+ K I K ++N+ R M D Y FED ++P Sbjct: 299 VSGDFDDSLDTNDGEEEQKPEENRETKDPAVKIEAKASRNNKRRWMVDFYSGFEDFELAP 358 Query: 445 VVKSKRGRNQVLPHKYRDSVLDPWK 371 VVKSKRGRNQVLP KYRDSVL+PWK Sbjct: 359 VVKSKRGRNQVLPRKYRDSVLEPWK 383