BLASTX nr result
ID: Papaver27_contig00050752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00050752 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -1 Query: 352 ARISFFGSTKRELDQKLDRGQDAAGRRRLIQVP 254 ARISFFGSTK EL QK DRGQDA GRRRL QVP Sbjct: 10 ARISFFGSTKGELAQKWDRGQDAVGRRRLTQVP 42