BLASTX nr result
ID: Papaver27_contig00049684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00049684 (617 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846296.1| hypothetical protein AMTR_s00012p00252270 [A... 59 1e-06 ref|XP_007206069.1| hypothetical protein PRUPE_ppa012764mg [Prun... 59 1e-06 >ref|XP_006846296.1| hypothetical protein AMTR_s00012p00252270 [Amborella trichopoda] gi|548849066|gb|ERN07971.1| hypothetical protein AMTR_s00012p00252270 [Amborella trichopoda] Length = 275 Score = 58.9 bits (141), Expect = 1e-06 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 5/80 (6%) Frame = -2 Query: 601 ELLVDVNKEFVEFLEKELNITDANVEEGNNTKTAEGKARER---SQRRGIHNDPGKQSSI 431 E L ++ +EFVEFLEKELNITD N+ GN + E K+ E+ + N +++S+ Sbjct: 196 EELAEIGEEFVEFLEKELNITDENINAGNPDRDDEVKSNEKPGSQTKEDAQNQARRETSV 255 Query: 430 KDC--EIEATLSQLLTKESG 377 +D EIEATL Q L KE G Sbjct: 256 EDSIDEIEATLRQ-LKKELG 274 >ref|XP_007206069.1| hypothetical protein PRUPE_ppa012764mg [Prunus persica] gi|462401711|gb|EMJ07268.1| hypothetical protein PRUPE_ppa012764mg [Prunus persica] Length = 155 Score = 58.9 bits (141), Expect = 1e-06 Identities = 42/81 (51%), Positives = 51/81 (62%), Gaps = 6/81 (7%) Frame = -2 Query: 601 ELLVDVNKEFVEFLEKELNITDANVEEGNNTK----TAEGKARERSQRRGIHNDPGKQSS 434 E L ++ +EFVEFLEKELNITD VEE NN + + G R S G N+ GK SS Sbjct: 78 EELGEIGEEFVEFLEKELNITDPEVEENNNKEGNPFRSSGTQRTGS---GNQNEAGKGSS 134 Query: 433 IKD--CEIEATLSQLLTKESG 377 I++ EIEATL+Q L KE G Sbjct: 135 IEENIDEIEATLAQ-LKKELG 154