BLASTX nr result
ID: Papaver27_contig00049482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00049482 (681 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 63 8e-08 ref|XP_007041612.1| Pentatricopeptide repeat (PPR) superfamily p... 60 7e-07 ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily p... 60 7e-07 ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citr... 59 1e-06 ref|XP_006296960.1| hypothetical protein CARUB_v10012952mg, part... 59 1e-06 ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. l... 58 2e-06 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 57 6e-06 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWEDT 112 SGLA++ LKRVQKGWGQGSIS++QPQK +FLDYWE T Sbjct: 841 SGLALKALKRVQKGWGQGSISSLQPQKNDFLDYWEGT 877 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWE 106 SG+A++ LKRVQKGWGQGSIS++QPQK EF DYW+ Sbjct: 837 SGIALKALKRVQKGWGQGSISSLQPQKLEFFDYWD 871 >ref|XP_007041612.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] gi|508705547|gb|EOX97443.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 632 Score = 60.1 bits (144), Expect = 7e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWE 106 SG+A++ LKRVQKGWGQGSIS +QP K +F DYWE Sbjct: 595 SGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWE 629 >ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508705546|gb|EOX97442.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 872 Score = 60.1 bits (144), Expect = 7e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWE 106 SG+A++ LKRVQKGWGQGSIS +QP K +F DYWE Sbjct: 835 SGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWE 869 >ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] gi|568866524|ref|XP_006486605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] Length = 889 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWE 106 SG+A++ LKRVQKGWGQGSIS++Q QK + LDYWE Sbjct: 840 SGIALKTLKRVQKGWGQGSISSLQAQKYDLLDYWE 874 >ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] gi|557524367|gb|ESR35673.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] Length = 889 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWE 106 SG+A++ LKRVQKGWGQGSIS++Q QK + LDYWE Sbjct: 840 SGIALKTLKRVQKGWGQGSISSLQAQKYDLLDYWE 874 >ref|XP_006296960.1| hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] gi|482565669|gb|EOA29858.1| hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] Length = 881 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWED 109 SG+A++ L RV+KGWGQG IS+ QPQ+ ++LDYWED Sbjct: 844 SGIALKTLSRVKKGWGQGDISSFQPQRDDYLDYWED 879 >ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like isoform X1 [Glycine max] Length = 875 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWE 106 SG+A++ LKRVQKGWGQGSIS++QPQ+ +FLDY++ Sbjct: 838 SGIALKTLKRVQKGWGQGSISSLQPQQNDFLDYYD 872 >ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329881|gb|EFH60300.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWED 109 SG+A++ L RV+KGWGQG IS+ QPQ+ ++LDYWED Sbjct: 837 SGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWED 872 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 57.0 bits (136), Expect = 6e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +2 Query: 2 SGLAVRVLKRVQKGWGQGSISNVQPQKKEFLDYWED 109 SG+A+R L RV+KGWGQG IS+ QP + ++LDYWED Sbjct: 837 SGIALRSLSRVKKGWGQGDISSFQPPRVDYLDYWED 872