BLASTX nr result
ID: Papaver27_contig00049250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00049250 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW87282.1| hypothetical protein ZEAMMB73_404562 [Zea mays] 59 7e-07 >gb|AFW87282.1| hypothetical protein ZEAMMB73_404562 [Zea mays] Length = 683 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +3 Query: 3 KITISSKMKSEDFYGEPQKQPSVVIHPPSDIEKYPRRKIIIKQLK-VDQVKEEVHDDIQE 179 KI I +KMKS+DF + K PSVV PP++ + PR+KI IKQ K +DQ + +QE Sbjct: 365 KIVIPNKMKSDDFPPDTPK-PSVVFRPPAEEKDVPRKKITIKQPKGIDQQRHVESRSVQE 423 Query: 180 EHRKTEKMMQLS 215 RKT K+++LS Sbjct: 424 PTRKTRKIVELS 435