BLASTX nr result
ID: Papaver27_contig00049239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00049239 (692 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007158561.1| hypothetical protein PHAVU_002G162800g [Phas... 107 5e-21 ref|XP_002271391.2| PREDICTED: protein SPA1-RELATED 2-like, part... 107 5e-21 emb|CBI34453.3| unnamed protein product [Vitis vinifera] 107 5e-21 ref|XP_006590495.1| PREDICTED: protein SPA1-RELATED 2-like [Glyc... 105 1e-20 ref|XP_003516717.1| PREDICTED: protein SPA1-RELATED 2-like [Glyc... 105 2e-20 ref|XP_007218675.1| hypothetical protein PRUPE_ppa014569mg [Prun... 104 2e-20 ref|XP_003611015.1| Histone acetyltransferase type B subunit [Me... 104 3e-20 ref|XP_007040447.1| Ubiquitin ligase protein cop1, putative isof... 103 4e-20 ref|XP_007040446.1| Ubiquitin ligase protein cop1, putative isof... 103 4e-20 ref|XP_007040445.1| Ubiquitin ligase protein cop1, putative isof... 103 4e-20 ref|XP_007040444.1| Ubiquitin ligase protein cop1, putative isof... 103 4e-20 ref|XP_007040441.1| Ubiquitin ligase protein cop1, putative isof... 103 4e-20 ref|XP_007040440.1| Ubiquitin ligase protein cop1, putative isof... 103 4e-20 gb|EXC02946.1| Protein SPA1-RELATED 2 [Morus notabilis] 103 7e-20 ref|XP_002509925.1| ubiquitin ligase protein cop1, putative [Ric... 102 9e-20 ref|XP_006654813.1| PREDICTED: protein SUPPRESSOR OF PHYA-105 1-... 102 1e-19 ref|XP_006397820.1| hypothetical protein EUTSA_v100012911mg, par... 102 1e-19 ref|XP_004511528.1| PREDICTED: protein SPA1-RELATED 2-like isofo... 102 1e-19 ref|XP_004511527.1| PREDICTED: protein SPA1-RELATED 2-like isofo... 102 1e-19 ref|XP_006293445.1| hypothetical protein CARUB_v10022559mg [Caps... 102 1e-19 >ref|XP_007158561.1| hypothetical protein PHAVU_002G162800g [Phaseolus vulgaris] gi|593791046|ref|XP_007158562.1| hypothetical protein PHAVU_002G162800g [Phaseolus vulgaris] gi|561031976|gb|ESW30555.1| hypothetical protein PHAVU_002G162800g [Phaseolus vulgaris] gi|561031977|gb|ESW30556.1| hypothetical protein PHAVU_002G162800g [Phaseolus vulgaris] Length = 1138 Score = 107 bits (266), Expect = 5e-21 Identities = 49/61 (80%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 SYYRSLP+PITSH+FGSIDPISG+++ DDNGQFVSSVCWR KS+M IAANS+G +KVLQM Sbjct: 1078 SYYRSLPMPITSHKFGSIDPISGKDTEDDNGQFVSSVCWRGKSDMLIAANSSGCVKVLQM 1137 Query: 183 V 185 V Sbjct: 1138 V 1138 >ref|XP_002271391.2| PREDICTED: protein SPA1-RELATED 2-like, partial [Vitis vinifera] Length = 1054 Score = 107 bits (266), Expect = 5e-21 Identities = 49/61 (80%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +Y+RSLP+PITSH+FGSIDPISG+E+ DDNGQFVSSVCWR KSNM +AANSTG IKVL+M Sbjct: 994 AYHRSLPMPITSHKFGSIDPISGKETDDDNGQFVSSVCWRGKSNMVVAANSTGCIKVLEM 1053 Query: 183 V 185 V Sbjct: 1054 V 1054 >emb|CBI34453.3| unnamed protein product [Vitis vinifera] Length = 799 Score = 107 bits (266), Expect = 5e-21 Identities = 49/61 (80%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +Y+RSLP+PITSH+FGSIDPISG+E+ DDNGQFVSSVCWR KSNM +AANSTG IKVL+M Sbjct: 739 AYHRSLPMPITSHKFGSIDPISGKETDDDNGQFVSSVCWRGKSNMVVAANSTGCIKVLEM 798 Query: 183 V 185 V Sbjct: 799 V 799 >ref|XP_006590495.1| PREDICTED: protein SPA1-RELATED 2-like [Glycine max] Length = 1123 Score = 105 bits (263), Expect = 1e-20 Identities = 48/61 (78%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+++ DDNGQFVSSVCWR KS+M IAANS+G +KVLQM Sbjct: 1063 TYYRSLPMPITSHKFGSIDPISGKDTDDDNGQFVSSVCWRGKSDMLIAANSSGCVKVLQM 1122 Query: 183 V 185 V Sbjct: 1123 V 1123 >ref|XP_003516717.1| PREDICTED: protein SPA1-RELATED 2-like [Glycine max] Length = 1129 Score = 105 bits (261), Expect = 2e-20 Identities = 47/61 (77%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+P+TSH+FGSIDPISG+++ DDNGQFVSSVCWR KS M IAANS+G +KVLQM Sbjct: 1069 TYYRSLPMPVTSHKFGSIDPISGKDTDDDNGQFVSSVCWRGKSGMLIAANSSGCVKVLQM 1128 Query: 183 V 185 V Sbjct: 1129 V 1129 >ref|XP_007218675.1| hypothetical protein PRUPE_ppa014569mg [Prunus persica] gi|462415137|gb|EMJ19874.1| hypothetical protein PRUPE_ppa014569mg [Prunus persica] Length = 1023 Score = 104 bits (260), Expect = 2e-20 Identities = 47/61 (77%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 SYYRSLP+PITSH+FGSIDP+SG E D +GQFVSSVCWR+KSN+ +AANSTGT+K+LQM Sbjct: 963 SYYRSLPMPITSHKFGSIDPVSGSEVGDYSGQFVSSVCWRKKSNILVAANSTGTLKLLQM 1022 Query: 183 V 185 V Sbjct: 1023 V 1023 >ref|XP_003611015.1| Histone acetyltransferase type B subunit [Medicago truncatula] gi|355512350|gb|AES93973.1| Histone acetyltransferase type B subunit [Medicago truncatula] Length = 1323 Score = 104 bits (259), Expect = 3e-20 Identities = 49/73 (67%), Positives = 61/73 (83%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YY+SLP+PITSH+FGSIDPISG+E+ DD+GQFVSSVCWR KSN +AANS+G IKVLQM Sbjct: 1090 TYYKSLPMPITSHKFGSIDPISGKETDDDHGQFVSSVCWRGKSNTLLAANSSGCIKVLQM 1149 Query: 183 V*GKVSLHIKKLE 221 V + +K+E Sbjct: 1150 VAAAPQISGRKVE 1162 >ref|XP_007040447.1| Ubiquitin ligase protein cop1, putative isoform 8 [Theobroma cacao] gi|508777692|gb|EOY24948.1| Ubiquitin ligase protein cop1, putative isoform 8 [Theobroma cacao] Length = 1102 Score = 103 bits (258), Expect = 4e-20 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+E+ DDNG FVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1042 AYYRSLPMPITSHKFGSIDPISGKETDDDNGLFVSSVCWRGKSDMVVAANSSGCIKVLQM 1101 Query: 183 V 185 V Sbjct: 1102 V 1102 >ref|XP_007040446.1| Ubiquitin ligase protein cop1, putative isoform 7 [Theobroma cacao] gi|508777691|gb|EOY24947.1| Ubiquitin ligase protein cop1, putative isoform 7 [Theobroma cacao] Length = 1103 Score = 103 bits (258), Expect = 4e-20 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+E+ DDNG FVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1043 AYYRSLPMPITSHKFGSIDPISGKETDDDNGLFVSSVCWRGKSDMVVAANSSGCIKVLQM 1102 Query: 183 V 185 V Sbjct: 1103 V 1103 >ref|XP_007040445.1| Ubiquitin ligase protein cop1, putative isoform 6 [Theobroma cacao] gi|508777690|gb|EOY24946.1| Ubiquitin ligase protein cop1, putative isoform 6 [Theobroma cacao] Length = 1083 Score = 103 bits (258), Expect = 4e-20 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+E+ DDNG FVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1023 AYYRSLPMPITSHKFGSIDPISGKETDDDNGLFVSSVCWRGKSDMVVAANSSGCIKVLQM 1082 Query: 183 V 185 V Sbjct: 1083 V 1083 >ref|XP_007040444.1| Ubiquitin ligase protein cop1, putative isoform 5 [Theobroma cacao] gi|508777689|gb|EOY24945.1| Ubiquitin ligase protein cop1, putative isoform 5 [Theobroma cacao] Length = 1066 Score = 103 bits (258), Expect = 4e-20 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+E+ DDNG FVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1006 AYYRSLPMPITSHKFGSIDPISGKETDDDNGLFVSSVCWRGKSDMVVAANSSGCIKVLQM 1065 Query: 183 V 185 V Sbjct: 1066 V 1066 >ref|XP_007040441.1| Ubiquitin ligase protein cop1, putative isoform 2 [Theobroma cacao] gi|508777686|gb|EOY24942.1| Ubiquitin ligase protein cop1, putative isoform 2 [Theobroma cacao] Length = 1082 Score = 103 bits (258), Expect = 4e-20 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+E+ DDNG FVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1022 AYYRSLPMPITSHKFGSIDPISGKETDDDNGLFVSSVCWRGKSDMVVAANSSGCIKVLQM 1081 Query: 183 V 185 V Sbjct: 1082 V 1082 >ref|XP_007040440.1| Ubiquitin ligase protein cop1, putative isoform 1 [Theobroma cacao] gi|590678944|ref|XP_007040442.1| Ubiquitin ligase protein cop1, putative isoform 1 [Theobroma cacao] gi|590678948|ref|XP_007040443.1| Ubiquitin ligase protein cop1, putative isoform 1 [Theobroma cacao] gi|508777685|gb|EOY24941.1| Ubiquitin ligase protein cop1, putative isoform 1 [Theobroma cacao] gi|508777687|gb|EOY24943.1| Ubiquitin ligase protein cop1, putative isoform 1 [Theobroma cacao] gi|508777688|gb|EOY24944.1| Ubiquitin ligase protein cop1, putative isoform 1 [Theobroma cacao] Length = 1067 Score = 103 bits (258), Expect = 4e-20 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSIDPISG+E+ DDNG FVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1007 AYYRSLPMPITSHKFGSIDPISGKETDDDNGLFVSSVCWRGKSDMVVAANSSGCIKVLQM 1066 Query: 183 V 185 V Sbjct: 1067 V 1067 >gb|EXC02946.1| Protein SPA1-RELATED 2 [Morus notabilis] Length = 1072 Score = 103 bits (256), Expect = 7e-20 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YYRSLP+PITSH+FGSID ISG+E+ DDNGQFVSSVCWR KS M +AANS+G IKVLQM Sbjct: 1012 AYYRSLPMPITSHKFGSIDSISGKETDDDNGQFVSSVCWRGKSEMVVAANSSGCIKVLQM 1071 Query: 183 V 185 V Sbjct: 1072 V 1072 >ref|XP_002509925.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223549824|gb|EEF51312.1| ubiquitin ligase protein cop1, putative [Ricinus communis] Length = 1044 Score = 102 bits (255), Expect = 9e-20 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +Y+RSLPVPITSH+FGSIDPISG+E+ DDNGQFVSSV WR KS+M IAANSTG IKVLQ+ Sbjct: 984 AYHRSLPVPITSHKFGSIDPISGKETDDDNGQFVSSVSWRGKSDMLIAANSTGCIKVLQV 1043 Query: 183 V 185 V Sbjct: 1044 V 1044 >ref|XP_006654813.1| PREDICTED: protein SUPPRESSOR OF PHYA-105 1-like [Oryza brachyantha] Length = 1142 Score = 102 bits (254), Expect = 1e-19 Identities = 45/61 (73%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 SYY++ P+PITSH+FGSIDPI+GQE++DDN QFVSSVCWR +SNM +AANSTG+IKVL++ Sbjct: 1082 SYYKNFPMPITSHKFGSIDPITGQETNDDNQQFVSSVCWRGRSNMVVAANSTGSIKVLEL 1141 Query: 183 V 185 V Sbjct: 1142 V 1142 >ref|XP_006397820.1| hypothetical protein EUTSA_v100012911mg, partial [Eutrema salsugineum] gi|557098893|gb|ESQ39273.1| hypothetical protein EUTSA_v100012911mg, partial [Eutrema salsugineum] Length = 777 Score = 102 bits (254), Expect = 1e-19 Identities = 45/61 (73%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 SYYRSLP+P+TS++FGS+DPISG E DDNGQFVSSVCWR+KSNM +AANSTG +K+L++ Sbjct: 717 SYYRSLPMPMTSYKFGSVDPISGNEYFDDNGQFVSSVCWRKKSNMLVAANSTGNMKLLKL 776 Query: 183 V 185 V Sbjct: 777 V 777 >ref|XP_004511528.1| PREDICTED: protein SPA1-RELATED 2-like isoform X4 [Cicer arietinum] Length = 1044 Score = 102 bits (254), Expect = 1e-19 Identities = 46/61 (75%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YY+SLP+PITSH++GSIDPISG+E+ DD+GQFVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 984 TYYKSLPMPITSHKYGSIDPISGKETDDDHGQFVSSVCWRGKSDMLLAANSSGCIKVLQM 1043 Query: 183 V 185 V Sbjct: 1044 V 1044 >ref|XP_004511527.1| PREDICTED: protein SPA1-RELATED 2-like isoform X3 [Cicer arietinum] Length = 1078 Score = 102 bits (254), Expect = 1e-19 Identities = 46/61 (75%), Positives = 57/61 (93%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 +YY+SLP+PITSH++GSIDPISG+E+ DD+GQFVSSVCWR KS+M +AANS+G IKVLQM Sbjct: 1018 TYYKSLPMPITSHKYGSIDPISGKETDDDHGQFVSSVCWRGKSDMLLAANSSGCIKVLQM 1077 Query: 183 V 185 V Sbjct: 1078 V 1078 >ref|XP_006293445.1| hypothetical protein CARUB_v10022559mg [Capsella rubella] gi|482562153|gb|EOA26343.1| hypothetical protein CARUB_v10022559mg [Capsella rubella] Length = 1027 Score = 102 bits (254), Expect = 1e-19 Identities = 45/61 (73%), Positives = 56/61 (91%) Frame = +3 Query: 3 SYYRSLPVPITSHQFGSIDPISGQESSDDNGQFVSSVCWRRKSNMFIAANSTGTIKVLQM 182 SYYRSLP+P+TS++FGS+DPISG E DDNGQFVSSVCWR+KSNM +AANSTG +K+L++ Sbjct: 967 SYYRSLPMPMTSYKFGSVDPISGNEYFDDNGQFVSSVCWRKKSNMLVAANSTGNMKLLKL 1026 Query: 183 V 185 V Sbjct: 1027 V 1027