BLASTX nr result
ID: Papaver27_contig00048675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00048675 (442 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007032963.1| Glutamine dumper 2, putative [Theobroma caca... 64 3e-08 ref|XP_006844172.1| hypothetical protein AMTR_s00006p00263100 [A... 62 8e-08 ref|XP_006373516.1| hypothetical protein POPTR_0017s14440g [Popu... 59 5e-07 ref|XP_002530814.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002530813.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_003551789.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [... 57 3e-06 >ref|XP_007032963.1| Glutamine dumper 2, putative [Theobroma cacao] gi|508711992|gb|EOY03889.1| Glutamine dumper 2, putative [Theobroma cacao] Length = 104 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/80 (45%), Positives = 43/80 (53%) Frame = -1 Query: 442 WNSPIPYLFAGLVAMXXXXXXXXXXXLCSYYKKTSPASHQEMVDIEKPAAVESVLQPLGM 263 WNSP+PYLF+GL M CSY K S ++H E EKPA + V L M Sbjct: 19 WNSPVPYLFSGLALMLGLISFALVILACSYKKSPSNSAHDEAE--EKPA--KQVSMQLEM 74 Query: 262 EPTIAVILPGDYIPRFLLKP 203 EP I VI+ GD P +L KP Sbjct: 75 EPKIVVIMAGDENPTYLAKP 94 >ref|XP_006844172.1| hypothetical protein AMTR_s00006p00263100 [Amborella trichopoda] gi|548846571|gb|ERN05847.1| hypothetical protein AMTR_s00006p00263100 [Amborella trichopoda] Length = 98 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/80 (41%), Positives = 41/80 (51%) Frame = -1 Query: 442 WNSPIPYLFAGLVAMXXXXXXXXXXXLCSYYKKTSPASHQEMVDIEKPAAVESVLQPLGM 263 W+SP+PYLF GL + LCSY K + + Q+ EKPA L PL M Sbjct: 16 WHSPVPYLFGGLAFILGLIAFALLILLCSYRKNSGESEEQQS---EKPANSIETLSPLDM 72 Query: 262 EPTIAVILPGDYIPRFLLKP 203 EP VI+ G+ P FL KP Sbjct: 73 EPKFVVIMAGEQTPTFLAKP 92 >ref|XP_006373516.1| hypothetical protein POPTR_0017s14440g [Populus trichocarpa] gi|550320338|gb|ERP51313.1| hypothetical protein POPTR_0017s14440g [Populus trichocarpa] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/80 (42%), Positives = 42/80 (52%) Frame = -1 Query: 442 WNSPIPYLFAGLVAMXXXXXXXXXXXLCSYYKKTSPASHQEMVDIEKPAAVESVLQPLGM 263 WNSP+ Y F GL M CSY K S +S + D EKPA E + + + Sbjct: 20 WNSPVVYFFVGLAFMLGLITVALIILACSYRKSLSSSSRSDAGD-EKPAKHEEI--QVDL 76 Query: 262 EPTIAVILPGDYIPRFLLKP 203 EP IAVI+ GD P +LLKP Sbjct: 77 EPKIAVIMAGDENPTYLLKP 96 >ref|XP_002530814.1| conserved hypothetical protein [Ricinus communis] gi|223529635|gb|EEF31582.1| conserved hypothetical protein [Ricinus communis] Length = 115 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/82 (41%), Positives = 41/82 (50%) Frame = -1 Query: 442 WNSPIPYLFAGLVAMXXXXXXXXXXXLCSYYKKTSPASHQEMVDIEKPAAVESVLQPLGM 263 W+SP+PYLF GL M CSY K S S + + EKP A ++ L Sbjct: 16 WSSPMPYLFGGLALMLGVIAVALIILACSYRKSLSDESRGDGHE-EKPGAKQAELTVDSD 74 Query: 262 EPTIAVILPGDYIPRFLLKPFP 197 EP I VI+ GD P FL KP P Sbjct: 75 EPKIVVIMAGDDNPTFLAKPKP 96 >ref|XP_002530813.1| conserved hypothetical protein [Ricinus communis] gi|223529634|gb|EEF31581.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/82 (41%), Positives = 42/82 (51%) Frame = -1 Query: 442 WNSPIPYLFAGLVAMXXXXXXXXXXXLCSYYKKTSPASHQEMVDIEKPAAVESVLQPLGM 263 W+SPIPYLF GL + CSY K S S ++ + EKP A + + Sbjct: 19 WSSPIPYLFGGLALILGIIAVALIILACSYRKSLSNESTEDGHE-EKPGARQVEIMVDSD 77 Query: 262 EPTIAVILPGDYIPRFLLKPFP 197 EP IAVI+ GD P FL KP P Sbjct: 78 EPKIAVIMAGDDNPTFLAKPKP 99 >ref|XP_003551789.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Glycine max] Length = 123 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/80 (36%), Positives = 41/80 (51%) Frame = -1 Query: 442 WNSPIPYLFAGLVAMXXXXXXXXXXXLCSYYKKTSPASHQEMVDIEKPAAVESVLQPLGM 263 W SPIPYLF GL M +CSY K+ S +S + D++ A ++ Sbjct: 21 WKSPIPYLFGGLAVMLAIISMALVILVCSYRKRDSQSSSEVNEDVKSQAMANNL--ETNS 78 Query: 262 EPTIAVILPGDYIPRFLLKP 203 EP + VI+ GD+ P +L KP Sbjct: 79 EPEVLVIMAGDHNPTYLAKP 98