BLASTX nr result
ID: Papaver27_contig00048624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00048624 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494701.1| PREDICTED: B3 domain-containing transcriptio... 74 2e-11 emb|CAN72783.1| hypothetical protein VITISV_008016 [Vitis vinifera] 72 8e-11 ref|XP_002519140.1| sulfotransferase, putative [Ricinus communis... 69 5e-10 ref|XP_006406545.1| hypothetical protein EUTSA_v10021075mg [Eutr... 67 3e-09 ref|XP_006299472.1| hypothetical protein CARUB_v10015637mg [Caps... 66 4e-09 ref|NP_188529.2| B3 domain-containing transcription factor VRN1 ... 66 4e-09 ref|XP_002885287.1| hypothetical protein ARALYDRAFT_479415 [Arab... 66 4e-09 ref|XP_006423232.1| hypothetical protein CICLE_v10029988mg [Citr... 65 1e-08 ref|XP_007148606.1| hypothetical protein PHAVU_005G000700g [Phas... 65 1e-08 ref|XP_007042301.1| Uncharacterized protein TCM_006967 [Theobrom... 65 1e-08 ref|XP_004153259.1| PREDICTED: B3 domain-containing transcriptio... 65 1e-08 ref|XP_003555681.1| PREDICTED: B3 domain-containing transcriptio... 65 1e-08 ref|XP_003522606.1| PREDICTED: B3 domain-containing transcriptio... 64 2e-08 ref|XP_006479394.1| PREDICTED: B3 domain-containing transcriptio... 63 4e-08 ref|XP_006423108.1| hypothetical protein CICLE_v10028501mg [Citr... 63 4e-08 ref|XP_007042308.1| Uncharacterized protein TCM_006970 [Theobrom... 63 4e-08 ref|XP_007047113.1| AP2/B3-like transcriptional factor family pr... 63 4e-08 gb|EXB63661.1| B3 domain-containing transcription factor VRN1 [M... 63 5e-08 ref|XP_006479391.1| PREDICTED: B3 domain-containing transcriptio... 63 5e-08 ref|XP_006485078.1| PREDICTED: B3 domain-containing protein At4g... 62 8e-08 >ref|XP_006494701.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] Length = 290 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/71 (47%), Positives = 47/71 (66%) Frame = -2 Query: 223 KMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEIL 44 K S FF +HA+ IE +L +P+ FV KF ELS VA + +PNG VWRV L + +G I Sbjct: 7 KSPSHFFKAIHASTIEDKKLMIPQEFVRKFGYELSAVATLAVPNGCVWRVGLTKDEGSIW 66 Query: 43 FGSGWKDFMDY 11 F +GW +F++Y Sbjct: 67 FQNGWHEFVEY 77 >emb|CAN72783.1| hypothetical protein VITISV_008016 [Vitis vinifera] Length = 749 Score = 72.0 bits (175), Expect = 8e-11 Identities = 26/69 (37%), Positives = 46/69 (66%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 FF I+H+ I+ G L +PKRFV ++ LS++ + +P+G VW+V L+ GE+ GW Sbjct: 25 FFKIIHSTILRDGTLGIPKRFVSRYGKNLSNIMFLKVPSGAVWQVGLKRGDGEVWLDGGW 84 Query: 28 KDFMDYFPL 2 ++F++Y+ + Sbjct: 85 REFVEYYSI 93 >ref|XP_002519140.1| sulfotransferase, putative [Ricinus communis] gi|223541803|gb|EEF43351.1| sulfotransferase, putative [Ricinus communis] Length = 591 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/69 (37%), Positives = 50/69 (72%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 F+ ++ A+I+ +L +P++FV K+R ELS +A +T+PNG++W V+L + ++ F SGW Sbjct: 21 FYKLIVASILHDKKLRIPEKFVKKYRDELSCIATLTVPNGRIWVVELEKVNKKLWFCSGW 80 Query: 28 KDFMDYFPL 2 +F++Y+ + Sbjct: 81 HEFVEYYSI 89 >ref|XP_006406545.1| hypothetical protein EUTSA_v10021075mg [Eutrema salsugineum] gi|312282979|dbj|BAJ34355.1| unnamed protein product [Thellungiella halophila] gi|557107691|gb|ESQ47998.1| hypothetical protein EUTSA_v10021075mg [Eutrema salsugineum] Length = 341 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/69 (39%), Positives = 47/69 (68%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 F ++ ++ I++ L +P +FV KF+ ELS +T+P+G VWRV LR+A+ +I F GW Sbjct: 6 FHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKAENKIWFQDGW 65 Query: 28 KDFMDYFPL 2 ++F+D + + Sbjct: 66 QEFVDRYSI 74 >ref|XP_006299472.1| hypothetical protein CARUB_v10015637mg [Capsella rubella] gi|482568181|gb|EOA32370.1| hypothetical protein CARUB_v10015637mg [Capsella rubella] Length = 341 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/69 (39%), Positives = 46/69 (66%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 F ++ ++ I++ L +P +FV KF+ ELS +T+P+G VWRV LR+A +I F GW Sbjct: 6 FHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIWFQDGW 65 Query: 28 KDFMDYFPL 2 ++F+D + + Sbjct: 66 QEFVDRYSI 74 >ref|NP_188529.2| B3 domain-containing transcription factor VRN1 [Arabidopsis thaliana] gi|75153628|sp|Q8L3W1.1|VRN1_ARATH RecName: Full=B3 domain-containing transcription factor VRN1; AltName: Full=Protein VERNALIZATION 1 gi|21734794|gb|AAM76972.1|AF289051_1 reduced vernalization response 1 [Arabidopsis thaliana] gi|21734796|gb|AAM76973.1|AF289052_1 reduced vernalization response 1 [Arabidopsis thaliana] gi|89000959|gb|ABD59069.1| At3g18990 [Arabidopsis thaliana] gi|110741272|dbj|BAF02186.1| hypothetical protein [Arabidopsis thaliana] gi|225898655|dbj|BAH30458.1| hypothetical protein [Arabidopsis thaliana] gi|332642657|gb|AEE76178.1| B3 domain-containing transcription factor VRN1 [Arabidopsis thaliana] Length = 341 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/69 (39%), Positives = 46/69 (66%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 F ++ ++ I++ L +P +FV KF+ ELS +T+P+G VWRV LR+A +I F GW Sbjct: 6 FHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIWFQDGW 65 Query: 28 KDFMDYFPL 2 ++F+D + + Sbjct: 66 QEFVDRYSI 74 >ref|XP_002885287.1| hypothetical protein ARALYDRAFT_479415 [Arabidopsis lyrata subsp. lyrata] gi|297331127|gb|EFH61546.1| hypothetical protein ARALYDRAFT_479415 [Arabidopsis lyrata subsp. lyrata] Length = 341 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/69 (39%), Positives = 46/69 (66%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 F ++ ++ I++ L +P +FV KF+ ELS +T+P+G VWRV LR+A +I F GW Sbjct: 6 FHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIWFQDGW 65 Query: 28 KDFMDYFPL 2 ++F+D + + Sbjct: 66 QEFVDRYSI 74 >ref|XP_006423232.1| hypothetical protein CICLE_v10029988mg [Citrus clementina] gi|568867702|ref|XP_006487172.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] gi|557525166|gb|ESR36472.1| hypothetical protein CICLE_v10029988mg [Citrus clementina] Length = 359 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 2/84 (2%) Frame = -2 Query: 256 QRKNTPSFHS--KKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQV 83 +R+ P S KK S FF ++ A IE ++ +P+ FVG+F ELS VA +T P G V Sbjct: 4 RRRAEPKMASSMKKTNSLFFQVILAVTIEDKKMKIPQNFVGRFGDELSYVATLTNPKGYV 63 Query: 82 WRVQLREAKGEILFGSGWKDFMDY 11 R+ + + +G+I F GW +F+ Y Sbjct: 64 VRIGITKKEGKIWFDDGWNEFVQY 87 >ref|XP_007148606.1| hypothetical protein PHAVU_005G000700g [Phaseolus vulgaris] gi|561021870|gb|ESW20600.1| hypothetical protein PHAVU_005G000700g [Phaseolus vulgaris] Length = 314 Score = 64.7 bits (156), Expect = 1e-08 Identities = 24/76 (31%), Positives = 51/76 (67%) Frame = -2 Query: 229 SKKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGE 50 +++ + F I+ + I ++ +P+ F+ +F ELS VA IT+P+G+VW+++L++ + Sbjct: 15 AERESKHFLKIILPSAIHATQMRIPEEFIKRFGDELSTVATITVPDGRVWKMRLKKCGKD 74 Query: 49 ILFGSGWKDFMDYFPL 2 + F S W++F++Y+ L Sbjct: 75 VFFSSKWREFVNYYSL 90 >ref|XP_007042301.1| Uncharacterized protein TCM_006967 [Theobroma cacao] gi|508706236|gb|EOX98132.1| Uncharacterized protein TCM_006967 [Theobroma cacao] Length = 444 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/81 (38%), Positives = 44/81 (54%) Frame = -2 Query: 253 RKNTPSFHSKKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRV 74 RK S H + FF I+ I + L +P +FVGKF ELS VA +PNG+ W++ Sbjct: 6 RKRPRSNHVVDESLHFFKIILPRTIAEKNLTIPNKFVGKFGHELSGVATFVLPNGRKWKI 65 Query: 73 QLREAKGEILFGSGWKDFMDY 11 L +A I GW +F++Y Sbjct: 66 GLTKADDRIWLDDGWHEFIEY 86 >ref|XP_004153259.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Cucumis sativus] gi|449502391|ref|XP_004161627.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Cucumis sativus] Length = 412 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/81 (37%), Positives = 47/81 (58%) Frame = -2 Query: 244 TPSFHSKKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLR 65 T F K F +V + I+ +L +P+ FV R ELS VA +T+P+G VWRV LR Sbjct: 9 TGGFKRKMPRPHFHKLVLTSTIQARKLRIPETFVRMIRDELSAVATLTVPDGHVWRVGLR 68 Query: 64 EAKGEILFGSGWKDFMDYFPL 2 +A + F GW+ F++++ + Sbjct: 69 KADNKFWFEDGWQGFLEHYSI 89 >ref|XP_003555681.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Glycine max] Length = 435 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/69 (36%), Positives = 45/69 (65%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 F +V ++ +L +P F+ K+ T+LS +A +T+P+G VWR+ L++A ILF GW Sbjct: 6 FHKLVLPTTLQSRQLRIPDNFLRKYGTQLSTIATLTVPDGSVWRIGLKKADNRILFVDGW 65 Query: 28 KDFMDYFPL 2 +DF+ ++ + Sbjct: 66 QDFVQHYSI 74 >ref|XP_003522606.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Glycine max] Length = 280 Score = 64.3 bits (155), Expect = 2e-08 Identities = 24/76 (31%), Positives = 51/76 (67%) Frame = -2 Query: 229 SKKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGE 50 S+ + F I+ + I ++ +P+ F+ +F ELS+VA +T+P+G+VW+++L++ + Sbjct: 19 SESNSKHFLKIILPSPIHANQMRIPEEFIKRFGDELSNVATVTVPDGRVWKMRLKKCGKD 78 Query: 49 ILFGSGWKDFMDYFPL 2 + F S W++F++Y+ L Sbjct: 79 VSFRSKWREFVEYYSL 94 >ref|XP_006479394.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] Length = 416 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/77 (35%), Positives = 50/77 (64%) Frame = -2 Query: 241 PSFHSKKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLRE 62 P ++K + F+ ++ +I+ +L +P +FV KF ELS VA +TIP+G++W V+LR+ Sbjct: 21 PEEENQKRSCIFYKLIVPSILHDKKLRIPNKFVKKFGDELSTVAKLTIPSGRLWLVELRK 80 Query: 61 AKGEILFGSGWKDFMDY 11 ++ F GW +F+++ Sbjct: 81 LNKKLWFDIGWHEFIEH 97 >ref|XP_006423108.1| hypothetical protein CICLE_v10028501mg [Citrus clementina] gi|557525042|gb|ESR36348.1| hypothetical protein CICLE_v10028501mg [Citrus clementina] Length = 426 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/77 (35%), Positives = 50/77 (64%) Frame = -2 Query: 241 PSFHSKKMASRFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLRE 62 P ++K + F+ ++ +I+ +L +P +FV KF ELS VA +TIP+G++W V+LR+ Sbjct: 21 PEEENQKRSCIFYKLIVPSILHDKKLRIPNKFVKKFGDELSTVAKLTIPSGRLWLVELRK 80 Query: 61 AKGEILFGSGWKDFMDY 11 ++ F GW +F+++ Sbjct: 81 LNKKLWFDIGWHEFIEH 97 >ref|XP_007042308.1| Uncharacterized protein TCM_006970 [Theobroma cacao] gi|508706243|gb|EOX98139.1| Uncharacterized protein TCM_006970 [Theobroma cacao] Length = 465 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%) Frame = -2 Query: 253 RKNTPSFHSKKMAS-RFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWR 77 RK S H + S FF I+ I + +L +PK+FVGKF ELS +A +PNG+ W+ Sbjct: 21 RKRPRSNHVVEEESLHFFKIILPHTIAEKKLKIPKKFVGKFGHELSSLATFVLPNGRKWK 80 Query: 76 VQLREAKGEILFGSGWKDFMDY 11 + L +A I GW +F++Y Sbjct: 81 IGLTKADDRIWLDDGWHEFVEY 102 >ref|XP_007047113.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma cacao] gi|508699374|gb|EOX91270.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma cacao] Length = 567 Score = 63.2 bits (152), Expect = 4e-08 Identities = 23/69 (33%), Positives = 47/69 (68%) Frame = -2 Query: 208 FFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGW 29 FF I+ + G+L +P +FV K+ +S A++ +PNG+VW+V+L ++ G++ +GW Sbjct: 21 FFKIILPETLRDGKLGIPTKFVKKYGNGMSSPALLKVPNGEVWKVELTKSDGKVWLKNGW 80 Query: 28 KDFMDYFPL 2 ++F++++ L Sbjct: 81 QEFLNHYSL 89 >gb|EXB63661.1| B3 domain-containing transcription factor VRN1 [Morus notabilis] Length = 467 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/65 (41%), Positives = 42/65 (64%) Frame = -2 Query: 196 VHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSGWKDFM 17 V + + + +P+ FV KFR ELS VA I +P+G VWRV L++A +I F GW+DF+ Sbjct: 57 VFGVVFLRFRIRIPENFVKKFRDELSTVATINVPDGHVWRVGLKKADNKIWFHDGWQDFV 116 Query: 16 DYFPL 2 + + + Sbjct: 117 ERYAI 121 >ref|XP_006479391.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] Length = 347 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 8/78 (10%) Frame = -2 Query: 226 KKMAS-------RFFSIVHAAIIEKGELALPKRFVGKFR-TELSDVAVITIPNGQVWRVQ 71 KKMA RFF ++ +I+E+ +L +PK FVG+F ELS A + PNG VW+V Sbjct: 16 KKMAGSRATEPFRFFRVILPSILEQKKLKIPKAFVGRFGYEELSSDATLKTPNGCVWQVG 75 Query: 70 LREAKGEILFGSGWKDFM 17 + + KG+IL GW DF+ Sbjct: 76 VTKDKGKILLDDGWHDFV 93 >ref|XP_006485078.1| PREDICTED: B3 domain-containing protein At4g01580-like isoform X2 [Citrus sinensis] Length = 252 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/68 (38%), Positives = 42/68 (61%) Frame = -2 Query: 211 RFFSIVHAAIIEKGELALPKRFVGKFRTELSDVAVITIPNGQVWRVQLREAKGEILFGSG 32 +FF ++ +E +L +P +FV F ELS+ A + +PNG+ WRV+L+ +G + F G Sbjct: 7 QFFKVILPLSLEHKKLRIPPKFVRDFGHELSEDATLAVPNGRPWRVRLKRDEGGVWFDDG 66 Query: 31 WKDFMDYF 8 W DF Y+ Sbjct: 67 WYDFAKYY 74