BLASTX nr result
ID: Papaver27_contig00048474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00048474 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW74035.1| hypothetical protein ZEAMMB73_786558 [Zea mays] 56 6e-06 ref|NP_001170637.1| hypothetical protein [Zea mays] gi|238006528... 56 6e-06 >gb|AFW74035.1| hypothetical protein ZEAMMB73_786558 [Zea mays] Length = 335 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -2 Query: 417 CIIPLKKAEDGLVKKFSTSGLDGKVAIWDIES 322 CI+PL+K DG +K+FSTSGLDGKV +WD+E+ Sbjct: 298 CIVPLRKGSDGTIKRFSTSGLDGKVVVWDLEN 329 >ref|NP_001170637.1| hypothetical protein [Zea mays] gi|238006528|gb|ACR34299.1| unknown [Zea mays] gi|413939486|gb|AFW74037.1| hypothetical protein ZEAMMB73_786558 [Zea mays] gi|413939487|gb|AFW74038.1| hypothetical protein ZEAMMB73_786558 [Zea mays] Length = 375 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -2 Query: 417 CIIPLKKAEDGLVKKFSTSGLDGKVAIWDIES 322 CI+PL+K DG +K+FSTSGLDGKV +WD+E+ Sbjct: 338 CIVPLRKGSDGTIKRFSTSGLDGKVVVWDLEN 369