BLASTX nr result
ID: Papaver27_contig00047902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00047902 (867 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36569.1| unknown [Medicago truncatula] 58 5e-06 ref|XP_003627672.1| Cytochrome P450 [Medicago truncatula] gi|355... 58 5e-06 ref|XP_003636833.1| Cytochrome P450 [Medicago truncatula] gi|355... 58 5e-06 ref|XP_003636248.1| Cytochrome P450 [Medicago truncatula] gi|355... 58 5e-06 ref|XP_003636308.1| Cytochrome P450 [Medicago truncatula] gi|358... 57 9e-06 ref|XP_003636249.1| Cytochrome P450 [Medicago truncatula] gi|355... 57 9e-06 ref|XP_003627673.1| Cytochrome P450 [Medicago truncatula] gi|355... 57 9e-06 >gb|AFK36569.1| unknown [Medicago truncatula] Length = 230 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FATNLT+ ILDKM+YLHAALTETLRLYP Sbjct: 68 NIDEFATNLTDSILDKMHYLHAALTETLRLYP 99 >ref|XP_003627672.1| Cytochrome P450 [Medicago truncatula] gi|355521694|gb|AET02148.1| Cytochrome P450 [Medicago truncatula] Length = 511 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FATNLT+ ILDKM+YLHAALTETLRLYP Sbjct: 349 NIDEFATNLTDSILDKMHYLHAALTETLRLYP 380 >ref|XP_003636833.1| Cytochrome P450 [Medicago truncatula] gi|355502768|gb|AES83971.1| Cytochrome P450 [Medicago truncatula] Length = 1639 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FATNLT+ ILDKM+YLHAALTETLRLYP Sbjct: 349 NIDEFATNLTDSILDKMHYLHAALTETLRLYP 380 >ref|XP_003636248.1| Cytochrome P450 [Medicago truncatula] gi|355502183|gb|AES83386.1| Cytochrome P450 [Medicago truncatula] Length = 248 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FATNLT+ ILDKM+YLHAALTETLRLYP Sbjct: 86 NIDEFATNLTDSILDKMHYLHAALTETLRLYP 117 >ref|XP_003636308.1| Cytochrome P450 [Medicago truncatula] gi|358345539|ref|XP_003636834.1| Cytochrome P450 [Medicago truncatula] gi|355502243|gb|AES83446.1| Cytochrome P450 [Medicago truncatula] gi|355502769|gb|AES83972.1| Cytochrome P450 [Medicago truncatula] Length = 542 Score = 57.0 bits (136), Expect = 9e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FA NLT++ILDKM+YLHAALTETLRLYP Sbjct: 380 NIDEFAGNLTDVILDKMHYLHAALTETLRLYP 411 >ref|XP_003636249.1| Cytochrome P450 [Medicago truncatula] gi|355502184|gb|AES83387.1| Cytochrome P450 [Medicago truncatula] Length = 333 Score = 57.0 bits (136), Expect = 9e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FA NLT++ILDKM+YLHAALTETLRLYP Sbjct: 171 NIDEFAGNLTDVILDKMHYLHAALTETLRLYP 202 >ref|XP_003627673.1| Cytochrome P450 [Medicago truncatula] gi|355521695|gb|AET02149.1| Cytochrome P450 [Medicago truncatula] Length = 510 Score = 57.0 bits (136), Expect = 9e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 97 NIADFATNLTEIILDKMNYLHAALTETLRLYP 2 NI +FA NLT++ILDKM+YLHAALTETLRLYP Sbjct: 348 NIDEFAGNLTDVILDKMHYLHAALTETLRLYP 379