BLASTX nr result
ID: Papaver27_contig00047499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00047499 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462534.1| hypothetical protein SORBIDRAFT_02g027570 [S... 56 5e-06 >ref|XP_002462534.1| hypothetical protein SORBIDRAFT_02g027570 [Sorghum bicolor] gi|241925911|gb|EER99055.1| hypothetical protein SORBIDRAFT_02g027570 [Sorghum bicolor] Length = 728 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/38 (68%), Positives = 30/38 (78%), Gaps = 2/38 (5%) Frame = +3 Query: 213 NNCRW--PMGVKYGSPVEDVMTKLAIQCRGWESVYSEL 320 +N +W MG+KYG PVEDV+T LAI CRGWESVYS L Sbjct: 422 HNTQWGDEMGLKYGCPVEDVITGLAIHCRGWESVYSNL 459