BLASTX nr result
ID: Papaver27_contig00045960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00045960 (620 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007158880.1| hypothetical protein PHAVU_002G189600g [Phas... 49 6e-07 >ref|XP_007158880.1| hypothetical protein PHAVU_002G189600g [Phaseolus vulgaris] gi|561032295|gb|ESW30874.1| hypothetical protein PHAVU_002G189600g [Phaseolus vulgaris] Length = 490 Score = 48.9 bits (115), Expect(2) = 6e-07 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = +2 Query: 8 NESVNAYETSTSQPRQPTCDDA---VPSKEISFRISVFQQIPGTLLVKASLQNKKRP 169 N+ ++ QP++ T +++ + +++ FRISVFQQIPGTLLVK SLQ+K P Sbjct: 409 NDLTIVNNSTDCQPKRETSNESSLNISLEKLCFRISVFQQIPGTLLVKGSLQDKNSP 465 Score = 30.8 bits (68), Expect(2) = 6e-07 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 171 LSGALSVLFQQLELSLKKDYC 233 LSGA SV+FQQLE +L+ +C Sbjct: 466 LSGAFSVIFQQLEEALRSKFC 486