BLASTX nr result
ID: Papaver27_contig00045598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00045598 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006490330.1| PREDICTED: uncharacterized protein LOC102620... 57 4e-06 ref|XP_006421860.1| hypothetical protein CICLE_v100055841mg, par... 57 4e-06 ref|XP_006421859.1| hypothetical protein CICLE_v100055841mg [Cit... 57 4e-06 >ref|XP_006490330.1| PREDICTED: uncharacterized protein LOC102620511 [Citrus sinensis] Length = 280 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 98 LCVGSFWNLPERAAKAQILEWLERQIRQIGLSDLMEKFHFP 220 LCV +W P+ A+K Q+LEW ERQI IGLSDL + +FP Sbjct: 170 LCVRGYWQTPDGASKTQLLEWFERQIENIGLSDLKDSLYFP 210 >ref|XP_006421860.1| hypothetical protein CICLE_v100055841mg, partial [Citrus clementina] gi|557523733|gb|ESR35100.1| hypothetical protein CICLE_v100055841mg, partial [Citrus clementina] Length = 213 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 98 LCVGSFWNLPERAAKAQILEWLERQIRQIGLSDLMEKFHFP 220 LCV +W P+ A+K Q+LEW ERQI IGLSDL + +FP Sbjct: 170 LCVRGYWQTPDGASKTQLLEWFERQIENIGLSDLKDSLYFP 210 >ref|XP_006421859.1| hypothetical protein CICLE_v100055841mg [Citrus clementina] gi|557523732|gb|ESR35099.1| hypothetical protein CICLE_v100055841mg [Citrus clementina] Length = 215 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +2 Query: 98 LCVGSFWNLPERAAKAQILEWLERQIRQIGLSDLMEKFHFP 220 LCV +W P+ A+K Q+LEW ERQI IGLSDL + +FP Sbjct: 170 LCVRGYWQTPDGASKTQLLEWFERQIENIGLSDLKDSLYFP 210