BLASTX nr result
ID: Papaver27_contig00043198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00043198 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277967.1| PREDICTED: uncharacterized protein LOC100267... 58 2e-06 >ref|XP_002277967.1| PREDICTED: uncharacterized protein LOC100267054 [Vitis vinifera] Length = 351 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 3 KYQKLVPKDHPYHRYFEDNMMATKVFSQMAGSQTS 107 KY++LVPK HPY RYF+DNM+AT+VFSQMA +Q S Sbjct: 313 KYRRLVPKGHPYARYFDDNMIATRVFSQMAENQRS 347