BLASTX nr result
ID: Papaver27_contig00043114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00043114 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511418.1| DNA binding protein, putative [Ricinus commu... 56 5e-06 ref|XP_007211000.1| hypothetical protein PRUPE_ppa020940mg [Prun... 56 6e-06 >ref|XP_002511418.1| DNA binding protein, putative [Ricinus communis] gi|223550533|gb|EEF52020.1| DNA binding protein, putative [Ricinus communis] Length = 173 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = +2 Query: 242 MKTCSKSGT--IDRKTIEKNRRIHMKALCFKLVSLIPPTTSTDHQNHSSKKVSSICKLAY 415 MK + +G+ +DRKT+E+NRRIHMK LCFKL SLIP + H HS +S +L + Sbjct: 1 MKKTNSTGSPKLDRKTVERNRRIHMKGLCFKLASLIP----SHHLKHSKDTLSQQDQLDH 56 Query: 416 ICSF*SH 436 ++ H Sbjct: 57 AAAYIKH 63 >ref|XP_007211000.1| hypothetical protein PRUPE_ppa020940mg [Prunus persica] gi|462406735|gb|EMJ12199.1| hypothetical protein PRUPE_ppa020940mg [Prunus persica] Length = 186 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 2/41 (4%) Frame = +2 Query: 242 MKTC--SKSGTIDRKTIEKNRRIHMKALCFKLVSLIPPTTS 358 MK C S +DRKT+E+NRRIHMK LCFKL SL+PP S Sbjct: 1 MKKCRGESSSKLDRKTVERNRRIHMKGLCFKLASLVPPQHS 41