BLASTX nr result
ID: Papaver27_contig00040286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00040286 (695 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30972.3| unnamed protein product [Vitis vinifera] 65 2e-08 ref|XP_002274153.1| PREDICTED: protein kinase PINOID [Vitis vini... 65 2e-08 ref|XP_002526605.1| serine/threonine protein kinase, putative [R... 63 8e-08 ref|XP_004504155.1| PREDICTED: protein kinase PINOID-like [Cicer... 63 1e-07 gb|EXB31424.1| Protein kinase PINOID [Morus notabilis] 61 3e-07 ref|XP_007159618.1| hypothetical protein PHAVU_002G252500g [Phas... 61 3e-07 ref|XP_007041112.1| Kinase superfamily protein isoform 1 [Theobr... 61 4e-07 ref|XP_006468268.1| PREDICTED: protein kinase PINOID-like [Citru... 56 1e-05 ref|XP_006448958.1| hypothetical protein CICLE_v10015211mg [Citr... 56 1e-05 >emb|CBI30972.3| unnamed protein product [Vitis vinifera] Length = 432 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+E IRSA F K+ L+F+DFKLVRRIGSGDI Sbjct: 127 LKPHRSSDSAYEAIRSAAFSRKSGLSFRDFKLVRRIGSGDI 167 >ref|XP_002274153.1| PREDICTED: protein kinase PINOID [Vitis vinifera] gi|147828664|emb|CAN62073.1| hypothetical protein VITISV_032865 [Vitis vinifera] Length = 451 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+E IRSA F K+ L+F+DFKLVRRIGSGDI Sbjct: 46 LKPHRSSDSAYEAIRSAAFSRKSGLSFRDFKLVRRIGSGDI 86 >ref|XP_002526605.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223534045|gb|EEF35764.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 465 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+ IRSA FR K L F+DF+L+RRIGSGDI Sbjct: 56 LKPHRSSDSAYSAIRSATFRRKTGLTFRDFRLIRRIGSGDI 96 >ref|XP_004504155.1| PREDICTED: protein kinase PINOID-like [Cicer arietinum] Length = 460 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 +KPHRSSD A+ IRSA FR K+AL F+DF L+RRIG+GDI Sbjct: 52 IKPHRSSDYAYSAIRSATFRRKSALTFRDFNLIRRIGAGDI 92 >gb|EXB31424.1| Protein kinase PINOID [Morus notabilis] Length = 487 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+ IRSA F K+ L F+DF+L+RRIGSGDI Sbjct: 72 LKPHRSSDFAYSAIRSATFGRKSGLTFRDFRLIRRIGSGDI 112 >ref|XP_007159618.1| hypothetical protein PHAVU_002G252500g [Phaseolus vulgaris] gi|561033033|gb|ESW31612.1| hypothetical protein PHAVU_002G252500g [Phaseolus vulgaris] Length = 475 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+ IRSA FR K AL F+DF L+RRIG+GDI Sbjct: 55 LKPHRSSDFAYSAIRSATFRRKAALTFRDFHLLRRIGAGDI 95 >ref|XP_007041112.1| Kinase superfamily protein isoform 1 [Theobroma cacao] gi|590681549|ref|XP_007041113.1| Kinase superfamily protein isoform 1 [Theobroma cacao] gi|508705047|gb|EOX96943.1| Kinase superfamily protein isoform 1 [Theobroma cacao] gi|508705048|gb|EOX96944.1| Kinase superfamily protein isoform 1 [Theobroma cacao] Length = 446 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+ IRSA F +K L F+DF+L+RRIGSGDI Sbjct: 52 LKPHRSSDFAYSAIRSATFASKTGLTFRDFRLLRRIGSGDI 92 >ref|XP_006468268.1| PREDICTED: protein kinase PINOID-like [Citrus sinensis] Length = 451 Score = 56.2 bits (134), Expect = 1e-05 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+ IRSA F K L F+DF L RRIG+GDI Sbjct: 53 LKPHRSSDFAYSAIRSATFGRKTGLTFRDFDLHRRIGAGDI 93 >ref|XP_006448958.1| hypothetical protein CICLE_v10015211mg [Citrus clementina] gi|557551569|gb|ESR62198.1| hypothetical protein CICLE_v10015211mg [Citrus clementina] Length = 451 Score = 56.2 bits (134), Expect = 1e-05 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -1 Query: 125 LKPHRSSDVAWEVIRSAIFRNKNALNFKDFKLVRRIGSGDI 3 LKPHRSSD A+ IRSA F K L F+DF L RRIG+GDI Sbjct: 53 LKPHRSSDFAYSAIRSATFGRKTGLTFRDFDLHRRIGAGDI 93