BLASTX nr result
ID: Papaver27_contig00040190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00040190 (707 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841419.1| hypothetical protein AMTR_s00003p00032960 [A... 57 6e-06 >ref|XP_006841419.1| hypothetical protein AMTR_s00003p00032960 [Amborella trichopoda] gi|548843440|gb|ERN03094.1| hypothetical protein AMTR_s00003p00032960 [Amborella trichopoda] Length = 559 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 609 YWKGFGLENVNIKTRRGFVPVDERMRVIDKDGK 707 + KG GLEN+N+ T RGFVPVDERMRVID DGK Sbjct: 351 FTKGLGLENINVVTERGFVPVDERMRVIDADGK 383