BLASTX nr result
ID: Papaver27_contig00040089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00040089 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015876.1| Pentatricopeptide repeat superfamily protein... 57 3e-06 >ref|XP_007015876.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508786239|gb|EOY33495.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 974 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 7/75 (9%) Frame = +3 Query: 177 PSINPHHYNNNPPQILHRS--SKIVTPNVKKFKPIQ-----ANTKQSLFLYNLYLQMYAN 335 PS P + P+ H S + I+ N+K+ KP A K +LF +NLYL++Y N Sbjct: 12 PSFPPFFLKHQTPKTAHFSQCNLIINHNLKQLKPTHFLKPHAYPKPTLFYFNLYLRLYIN 71 Query: 336 SGFMDEAQKLFDEMP 380 +GFM EA+ LFD MP Sbjct: 72 AGFMQEARDLFDSMP 86