BLASTX nr result
ID: Papaver27_contig00040028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00040028 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368059.1| PREDICTED: protein PIR-like, partial [Solanu... 64 2e-08 ref|XP_007030294.1| Transcription activators isoform 1 [Theobrom... 63 5e-08 gb|EMS54724.1| Protein PIR [Triticum urartu] 59 9e-07 gb|EYU22929.1| hypothetical protein MIMGU_mgv1a000342mg [Mimulus... 57 4e-06 ref|XP_006478985.1| PREDICTED: protein PIR-like [Citrus sinensis] 57 4e-06 ref|XP_006351868.1| PREDICTED: protein PIR-like isoform X2 [Sola... 57 4e-06 ref|XP_006351867.1| PREDICTED: protein PIR-like isoform X1 [Sola... 57 4e-06 ref|XP_007147240.1| hypothetical protein PHAVU_006G107600g [Phas... 57 4e-06 ref|XP_006443294.1| hypothetical protein CICLE_v10023801mg [Citr... 57 4e-06 ref|XP_006400387.1| hypothetical protein EUTSA_v10012457mg [Eutr... 57 4e-06 ref|XP_006400386.1| hypothetical protein EUTSA_v10012457mg [Eutr... 57 4e-06 ref|XP_002319128.2| hypothetical protein POPTR_0013s04800g [Popu... 57 4e-06 ref|XP_002325364.2| hypothetical protein POPTR_0019s04190g [Popu... 57 4e-06 ref|XP_006371116.1| hypothetical protein POPTR_0019s04190g [Popu... 57 4e-06 ref|XP_006854248.1| hypothetical protein AMTR_s00039p00011800 [A... 57 4e-06 gb|EPS72662.1| hypothetical protein M569_02094, partial [Genlise... 57 4e-06 ref|XP_004494762.1| PREDICTED: protein PIR-like [Cicer arietinum] 57 4e-06 ref|XP_006286909.1| hypothetical protein CARUB_v10000053mg [Caps... 57 4e-06 ref|XP_007208388.1| hypothetical protein PRUPE_ppa000317mg [Prun... 57 4e-06 ref|XP_004250342.1| PREDICTED: protein PIR-like [Solanum lycoper... 57 4e-06 >ref|XP_006368059.1| PREDICTED: protein PIR-like, partial [Solanum tuberosum] Length = 186 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVNKYP 262 EELDDLQIFLSTRWAILLNL VEMFRVNKYP Sbjct: 118 EELDDLQIFLSTRWAILLNLHVEMFRVNKYP 148 >ref|XP_007030294.1| Transcription activators isoform 1 [Theobroma cacao] gi|508718899|gb|EOY10796.1| Transcription activators isoform 1 [Theobroma cacao] Length = 1334 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVNKYPL 259 EELDDLQIFLS+RWAILLNL VEMFRVNKYP+ Sbjct: 203 EELDDLQIFLSSRWAILLNLHVEMFRVNKYPV 234 >gb|EMS54724.1| Protein PIR [Triticum urartu] Length = 1187 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVNKYP 262 EELDDLQIFLSTRWAILLNL EMFR N YP Sbjct: 186 EELDDLQIFLSTRWAILLNLHAEMFRTNTYP 216 >gb|EYU22929.1| hypothetical protein MIMGU_mgv1a000342mg [Mimulus guttatus] Length = 1231 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_006478985.1| PREDICTED: protein PIR-like [Citrus sinensis] Length = 1287 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 203 EELDDLQIFLSTRWAILLNLHVEMFRVN 230 >ref|XP_006351868.1| PREDICTED: protein PIR-like isoform X2 [Solanum tuberosum] gi|565370522|ref|XP_006351869.1| PREDICTED: protein PIR-like isoform X3 [Solanum tuberosum] Length = 1247 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 162 EELDDLQIFLSTRWAILLNLHVEMFRVN 189 >ref|XP_006351867.1| PREDICTED: protein PIR-like isoform X1 [Solanum tuberosum] Length = 1287 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_007147240.1| hypothetical protein PHAVU_006G107600g [Phaseolus vulgaris] gi|561020463|gb|ESW19234.1| hypothetical protein PHAVU_006G107600g [Phaseolus vulgaris] Length = 1130 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 239 EELDDLQIFLSTRWAILLNLHVEMFRVN 266 >ref|XP_006443294.1| hypothetical protein CICLE_v10023801mg [Citrus clementina] gi|557545556|gb|ESR56534.1| hypothetical protein CICLE_v10023801mg [Citrus clementina] Length = 1263 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 203 EELDDLQIFLSTRWAILLNLHVEMFRVN 230 >ref|XP_006400387.1| hypothetical protein EUTSA_v10012457mg [Eutrema salsugineum] gi|557101477|gb|ESQ41840.1| hypothetical protein EUTSA_v10012457mg [Eutrema salsugineum] Length = 1283 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_006400386.1| hypothetical protein EUTSA_v10012457mg [Eutrema salsugineum] gi|557101476|gb|ESQ41839.1| hypothetical protein EUTSA_v10012457mg [Eutrema salsugineum] Length = 1278 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_002319128.2| hypothetical protein POPTR_0013s04800g [Populus trichocarpa] gi|550324973|gb|EEE95051.2| hypothetical protein POPTR_0013s04800g [Populus trichocarpa] Length = 1305 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_002325364.2| hypothetical protein POPTR_0019s04190g [Populus trichocarpa] gi|550316749|gb|EEE99745.2| hypothetical protein POPTR_0019s04190g [Populus trichocarpa] Length = 568 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 176 EELDDLQIFLSTRWAILLNLHVEMFRVN 203 >ref|XP_006371116.1| hypothetical protein POPTR_0019s04190g [Populus trichocarpa] gi|550316748|gb|ERP48913.1| hypothetical protein POPTR_0019s04190g [Populus trichocarpa] Length = 555 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 176 EELDDLQIFLSTRWAILLNLHVEMFRVN 203 >ref|XP_006854248.1| hypothetical protein AMTR_s00039p00011800 [Amborella trichopoda] gi|548857924|gb|ERN15715.1| hypothetical protein AMTR_s00039p00011800 [Amborella trichopoda] Length = 370 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >gb|EPS72662.1| hypothetical protein M569_02094, partial [Genlisea aurea] Length = 1159 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 72 EELDDLQIFLSTRWAILLNLHVEMFRVN 99 >ref|XP_004494762.1| PREDICTED: protein PIR-like [Cicer arietinum] Length = 1277 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_006286909.1| hypothetical protein CARUB_v10000053mg [Capsella rubella] gi|482555615|gb|EOA19807.1| hypothetical protein CARUB_v10000053mg [Capsella rubella] Length = 1282 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229 >ref|XP_007208388.1| hypothetical protein PRUPE_ppa000317mg [Prunus persica] gi|462404030|gb|EMJ09587.1| hypothetical protein PRUPE_ppa000317mg [Prunus persica] Length = 1292 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 199 EELDDLQIFLSTRWAILLNLHVEMFRVN 226 >ref|XP_004250342.1| PREDICTED: protein PIR-like [Solanum lycopersicum] Length = 1287 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 354 EELDDLQIFLSTRWAILLNLQVEMFRVN 271 EELDDLQIFLSTRWAILLNL VEMFRVN Sbjct: 202 EELDDLQIFLSTRWAILLNLHVEMFRVN 229