BLASTX nr result
ID: Papaver27_contig00038660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00038660 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344375.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 ref|XP_004244962.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_004244961.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_002313317.2| hypothetical protein POPTR_0009s06340g [Popu... 82 8e-14 gb|EPS58661.1| hypothetical protein M569_16151 [Genlisea aurea] 80 3e-13 ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 emb|CBI24939.3| unnamed protein product [Vitis vinifera] 79 6e-13 emb|CAN83407.1| hypothetical protein VITISV_022679 [Vitis vinifera] 79 6e-13 ref|XP_007219329.1| hypothetical protein PRUPE_ppa019225mg, part... 78 1e-12 ref|XP_006403718.1| hypothetical protein EUTSA_v10011131mg, part... 76 5e-12 ref|XP_004308684.1| PREDICTED: pentatricopeptide repeat-containi... 76 5e-12 ref|XP_002877905.1| pentatricopeptide repeat-containing protein ... 75 9e-12 ref|NP_190885.5| pentatricopeptide repeat-containing protein [Ar... 75 1e-11 sp|Q9SCP4.1|PP279_ARATH RecName: Full=Pentatricopeptide repeat-c... 75 1e-11 gb|EXB68332.1| hypothetical protein L484_004678 [Morus notabilis] 74 2e-11 gb|EXB68330.1| hypothetical protein L484_004676 [Morus notabilis] 74 2e-11 ref|XP_006290968.1| hypothetical protein CARUB_v10017083mg [Caps... 73 5e-11 ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_002517779.1| pentatricopeptide repeat-containing protein,... 70 4e-10 ref|XP_003599420.1| Pentatricopeptide repeat-containing protein ... 67 3e-09 >ref|XP_006344375.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Solanum tuberosum] Length = 482 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/63 (66%), Positives = 56/63 (88%) Frame = +2 Query: 242 TSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWES 421 TS+G ++ SK NLSRILRTEAA++GI++KANS+K+TNL PKAVLEALDD+I +N+W+S Sbjct: 29 TSQGL--QKCSKKNLSRILRTEAAIRGIQRKANSEKYTNLWPKAVLEALDDAIRDNRWDS 86 Query: 422 SLK 430 +LK Sbjct: 87 ALK 89 >ref|XP_004244962.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform 2 [Solanum lycopersicum] Length = 454 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/68 (60%), Positives = 58/68 (85%) Frame = +2 Query: 227 NNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIAN 406 +++ TS+G ++ SK NLSRILRTEAA++GI +KANS+K+TNL PKAVL+ALDD+I + Sbjct: 25 SSSSSTSQGL--QKCSKKNLSRILRTEAAIRGIHRKANSEKYTNLWPKAVLKALDDAIRD 82 Query: 407 NQWESSLK 430 N+W+S+LK Sbjct: 83 NRWDSALK 90 >ref|XP_004244961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform 1 [Solanum lycopersicum] Length = 466 Score = 82.8 bits (203), Expect = 4e-14 Identities = 41/68 (60%), Positives = 58/68 (85%) Frame = +2 Query: 227 NNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIAN 406 +++ TS+G ++ SK NLSRILRTEAA++GI +KANS+K+TNL PKAVL+ALDD+I + Sbjct: 25 SSSSSTSQGL--QKCSKKNLSRILRTEAAIRGIHRKANSEKYTNLWPKAVLKALDDAIRD 82 Query: 407 NQWESSLK 430 N+W+S+LK Sbjct: 83 NRWDSALK 90 >ref|XP_002313317.2| hypothetical protein POPTR_0009s06340g [Populus trichocarpa] gi|550331160|gb|EEE87272.2| hypothetical protein POPTR_0009s06340g [Populus trichocarpa] Length = 483 Score = 82.0 bits (201), Expect = 8e-14 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = +2 Query: 242 TSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWES 421 TS G ++ SK LSRILRTEAA+K IE+KANS+K+ NL PKAVLEALDD+I NQWES Sbjct: 50 TSTGLQRQ--SKKELSRILRTEAAIKAIEQKANSKKYNNLWPKAVLEALDDAIKENQWES 107 Query: 422 SLK 430 +LK Sbjct: 108 ALK 110 >gb|EPS58661.1| hypothetical protein M569_16151 [Genlisea aurea] Length = 433 Score = 80.1 bits (196), Expect = 3e-13 Identities = 42/73 (57%), Positives = 53/73 (72%) Frame = +2 Query: 212 KKNSNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALD 391 K +S ++IE F + S+ NLS +LRT+AAVK I +KANS K+TNL PKAVLEALD Sbjct: 18 KSSSEKSDIEPGS-FRSRRSSRKNLSLLLRTDAAVKAIRRKANSSKYTNLWPKAVLEALD 76 Query: 392 DSIANNQWESSLK 430 D+I N WES+LK Sbjct: 77 DAIELNHWESALK 89 >ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Vitis vinifera] Length = 538 Score = 79.0 bits (193), Expect = 6e-13 Identities = 44/91 (48%), Positives = 63/91 (69%) Frame = +2 Query: 158 LNPSKTSKFPSHFLVRMGKKNSNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKA 337 L +K + P VR GK++S ++ G ++ K +LSRILRTEAA+ GIE+KA Sbjct: 29 LKETKPTSNPPFLFVRAGKRSSGSSQ----NGLQRQP--KKDLSRILRTEAAISGIERKA 82 Query: 338 NSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 NS+K++ L PKAVLEALD++I N++ES+LK Sbjct: 83 NSRKYSTLWPKAVLEALDEAIRENRYESALK 113 >emb|CBI24939.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 79.0 bits (193), Expect = 6e-13 Identities = 44/91 (48%), Positives = 63/91 (69%) Frame = +2 Query: 158 LNPSKTSKFPSHFLVRMGKKNSNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKA 337 L +K + P VR GK++S ++ G ++ K +LSRILRTEAA+ GIE+KA Sbjct: 29 LKETKPTSNPPFLFVRAGKRSSGSSQ----NGLQRQP--KKDLSRILRTEAAISGIERKA 82 Query: 338 NSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 NS+K++ L PKAVLEALD++I N++ES+LK Sbjct: 83 NSRKYSTLWPKAVLEALDEAIRENRYESALK 113 >emb|CAN83407.1| hypothetical protein VITISV_022679 [Vitis vinifera] Length = 166 Score = 79.0 bits (193), Expect = 6e-13 Identities = 44/91 (48%), Positives = 63/91 (69%) Frame = +2 Query: 158 LNPSKTSKFPSHFLVRMGKKNSNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKA 337 L +K + P VR GK++S ++ G ++ K +LSRILRTEAA+ GIE+KA Sbjct: 29 LKETKPTSNPPFLFVRAGKRSSGSSQ----NGLQRQP--KKDLSRILRTEAAISGIERKA 82 Query: 338 NSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 NS+K++ L PKAVLEALD++I N++ES+LK Sbjct: 83 NSRKYSTLWPKAVLEALDEAIRENRYESALK 113 >ref|XP_007219329.1| hypothetical protein PRUPE_ppa019225mg, partial [Prunus persica] gi|462415791|gb|EMJ20528.1| hypothetical protein PRUPE_ppa019225mg, partial [Prunus persica] Length = 473 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/53 (71%), Positives = 46/53 (86%) Frame = +2 Query: 272 SKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 +K LSR+LRT+AAV+ IEKKANS K+ NL PKAVLEALD++IANN WES+LK Sbjct: 56 AKKELSRLLRTDAAVRNIEKKANSNKYNNLWPKAVLEALDEAIANNLWESALK 108 >ref|XP_006403718.1| hypothetical protein EUTSA_v10011131mg, partial [Eutrema salsugineum] gi|557104837|gb|ESQ45171.1| hypothetical protein EUTSA_v10011131mg, partial [Eutrema salsugineum] Length = 495 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = +2 Query: 275 KGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 K LSRILRT+AAVKGIE+KANS+K+ L PKAVLEALD++I+ N+W+S+LK Sbjct: 83 KKELSRILRTDAAVKGIERKANSEKYNTLWPKAVLEALDEAISENRWQSALK 134 >ref|XP_004308684.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Fragaria vesca subsp. vesca] Length = 462 Score = 75.9 bits (185), Expect = 5e-12 Identities = 41/63 (65%), Positives = 49/63 (77%) Frame = +2 Query: 242 TSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWES 421 +S F QKE LSRILRTEAAVK IE+KANS K+ NL PK VLEALD++I+NN WE+ Sbjct: 36 SSGPFTQKE-----LSRILRTEAAVKNIERKANSNKYNNLWPKPVLEALDEAISNNLWEN 90 Query: 422 SLK 430 +LK Sbjct: 91 ALK 93 >ref|XP_002877905.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323743|gb|EFH54164.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 439 Score = 75.1 bits (183), Expect = 9e-12 Identities = 43/76 (56%), Positives = 54/76 (71%) Frame = +2 Query: 203 RMGKKNSNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLE 382 R GK NS + HQ + K LSRILRT+AAVKGIE+KANS+K+ L PKAVLE Sbjct: 10 RTGKMNSGLISTR-----HQIDPKK-ELSRILRTDAAVKGIERKANSEKYLTLWPKAVLE 63 Query: 383 ALDDSIANNQWESSLK 430 ALD++I N+W+S+LK Sbjct: 64 ALDEAIKENRWQSALK 79 >ref|NP_190885.5| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332645523|gb|AEE79044.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 499 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +2 Query: 275 KGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 K LSRILRT+AAVKGIE+KANS+K+ L PKAVLEALD++I N+W+S+LK Sbjct: 78 KKELSRILRTDAAVKGIERKANSEKYLTLWPKAVLEALDEAIKENRWQSALK 129 >sp|Q9SCP4.1|PP279_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53170 gi|6630737|emb|CAB64220.1| nodulin / glutamate-ammonia ligase-like protein [Arabidopsis thaliana] Length = 447 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +2 Query: 275 KGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 K LSRILRT+AAVKGIE+KANS+K+ L PKAVLEALD++I N+W+S+LK Sbjct: 28 KKELSRILRTDAAVKGIERKANSEKYLTLWPKAVLEALDEAIKENRWQSALK 79 >gb|EXB68332.1| hypothetical protein L484_004678 [Morus notabilis] Length = 488 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/70 (55%), Positives = 54/70 (77%) Frame = +2 Query: 221 SNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSI 400 S ++ + KG QK++ K +LSRILRT+AA++ IE+KANS+K+ NL PK VLEALD +I Sbjct: 48 SKRSSEGSGKGL-QKDHKK-DLSRILRTDAAIRNIERKANSKKYNNLWPKPVLEALDQAI 105 Query: 401 ANNQWESSLK 430 NN WE++LK Sbjct: 106 RNNYWETALK 115 >gb|EXB68330.1| hypothetical protein L484_004676 [Morus notabilis] Length = 445 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/70 (55%), Positives = 54/70 (77%) Frame = +2 Query: 221 SNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSI 400 S ++ + KG QK++ K +LSRILRT+AA++ IE+KANS+K+ NL PK VLEALD +I Sbjct: 48 SKRSSEGSGKGL-QKDHKK-DLSRILRTDAAIRNIERKANSKKYNNLWPKPVLEALDQAI 105 Query: 401 ANNQWESSLK 430 NN WE++LK Sbjct: 106 RNNYWETALK 115 >ref|XP_006290968.1| hypothetical protein CARUB_v10017083mg [Capsella rubella] gi|482559675|gb|EOA23866.1| hypothetical protein CARUB_v10017083mg [Capsella rubella] Length = 495 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +2 Query: 275 KGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 K LSRILR E+AVKGIE+KANS+K+ L PKAVLEALD++I N+W+S+LK Sbjct: 74 KKELSRILRAESAVKGIERKANSEKYLTLWPKAVLEALDEAIKENRWQSALK 125 >ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] gi|449514880|ref|XP_004164505.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] Length = 477 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = +2 Query: 260 QKEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 Q++ KG LSRILR +AA+K IE+KANS+K+ NL PKAVLEALD++I N WE++LK Sbjct: 57 QRDPKKG-LSRILRRDAAIKAIERKANSKKYNNLWPKAVLEALDEAIQENLWETALK 112 >ref|XP_002517779.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543051|gb|EEF44586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = +2 Query: 263 KEYSKGNLSRILRTEAAVKGIEKKANSQKFTNLSPKAVLEALDDSIANNQWESSLK 430 K ++K LSR LRT+AA+K IE+KA+S K+ L PKAVLEALDD+I +W+S+LK Sbjct: 58 KRHTKKELSRFLRTDAAIKAIEQKADSSKYNRLWPKAVLEALDDAIKERRWKSALK 113 >ref|XP_003599420.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355488468|gb|AES69671.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 511 Score = 67.0 bits (162), Expect = 3e-09 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 2/87 (2%) Frame = +2 Query: 173 TSKFPS--HFLVRMGKKNSNNNNIETSKGFHQKEYSKGNLSRILRTEAAVKGIEKKANSQ 346 ++KFP+ HF + S + + S QK+ K +LSRILRTEAA+KG+E KA S Sbjct: 31 STKFPNKNHFHSSSFRVYSLKRSSKPSYEGLQKDPKK-DLSRILRTEAAIKGVENKAKSW 89 Query: 347 KFTNLSPKAVLEALDDSIANNQWESSL 427 K L PKAVLEALDD+I QW+++L Sbjct: 90 KHKQLWPKAVLEALDDAIKGCQWQNAL 116