BLASTX nr result
ID: Papaver27_contig00038647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00038647 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358710.1| PREDICTED: exosome complex component MTR3-li... 58 2e-06 ref|XP_004240385.1| PREDICTED: exosome complex component MTR3-li... 58 2e-06 ref|XP_006846808.1| hypothetical protein AMTR_s00148p00071740 [A... 57 3e-06 gb|EYU18814.1| hypothetical protein MIMGU_mgv1a012266mg [Mimulus... 56 6e-06 ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [V... 55 8e-06 >ref|XP_006358710.1| PREDICTED: exosome complex component MTR3-like [Solanum tuberosum] Length = 255 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 INGEWSTPKIHEAMELCLTACSKLGELMRSYLTD 102 ++G WSTPKI+EAMELCL ACSKLGE+MRS L D Sbjct: 215 VSGGWSTPKINEAMELCLGACSKLGEVMRSCLKD 248 >ref|XP_004240385.1| PREDICTED: exosome complex component MTR3-like isoform 1 [Solanum lycopersicum] gi|460389492|ref|XP_004240386.1| PREDICTED: exosome complex component MTR3-like isoform 2 [Solanum lycopersicum] Length = 255 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 INGEWSTPKIHEAMELCLTACSKLGELMRSYLTD 102 ++G WSTPKI+EAMELCL ACSKLGE+MRS L D Sbjct: 215 VSGGWSTPKINEAMELCLGACSKLGEVMRSCLKD 248 >ref|XP_006846808.1| hypothetical protein AMTR_s00148p00071740 [Amborella trichopoda] gi|548849630|gb|ERN08389.1| hypothetical protein AMTR_s00148p00071740 [Amborella trichopoda] Length = 248 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 1 INGEWSTPKIHEAMELCLTACSKLGELMRSYLTD 102 + GEWSTPK+HEAM+LCL ACSKLG++MR L + Sbjct: 209 VTGEWSTPKVHEAMDLCLGACSKLGDIMRLCLKE 242 >gb|EYU18814.1| hypothetical protein MIMGU_mgv1a012266mg [Mimulus guttatus] Length = 256 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +1 Query: 1 INGEWSTPKIHEAMELCLTACSKLGELMRSYLTD 102 + GEWSTPKI+EAM+LC+ ACSKLG++MRS L + Sbjct: 216 VTGEWSTPKINEAMQLCIDACSKLGKIMRSCLKE 249 >ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [Vitis vinifera] gi|147834996|emb|CAN61380.1| hypothetical protein VITISV_037546 [Vitis vinifera] gi|297746275|emb|CBI16331.3| unnamed protein product [Vitis vinifera] Length = 254 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/34 (61%), Positives = 30/34 (88%) Frame = +1 Query: 1 INGEWSTPKIHEAMELCLTACSKLGELMRSYLTD 102 +NGEWSTP++HEAM++CL ACSKL +++RS L + Sbjct: 214 VNGEWSTPRVHEAMQICLEACSKLAKIIRSCLKE 247