BLASTX nr result
ID: Papaver27_contig00038000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00038000 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843443.1| hypothetical protein AMTR_s00053p00168120 [A... 76 4e-12 >ref|XP_006843443.1| hypothetical protein AMTR_s00053p00168120 [Amborella trichopoda] gi|548845810|gb|ERN05118.1| hypothetical protein AMTR_s00053p00168120 [Amborella trichopoda] Length = 425 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/67 (46%), Positives = 51/67 (76%) Frame = -2 Query: 476 QDYSPRLVFHVLRCYMLLCVHDRGFSAVLSYLLDPMLDGTFIESAEKFPIIGRLLDELLM 297 +D+SPRL+FH++RCY+LLC RGF+ ++ YL +P+ + +F + E+FP+I R+L++LLM Sbjct: 270 KDHSPRLLFHIIRCYVLLCTDTRGFNMLIDYLPEPITNNSFQQITEEFPVIRRMLEQLLM 329 Query: 296 TIGGNVQ 276 G V+ Sbjct: 330 NTGKVVE 336