BLASTX nr result
ID: Papaver27_contig00037707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00037707 (731 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42200.1| hypothetical protein MIMGU_mgv1a012059mg [Mimulus... 47 9e-06 >gb|EYU42200.1| hypothetical protein MIMGU_mgv1a012059mg [Mimulus guttatus] Length = 263 Score = 47.4 bits (111), Expect(2) = 9e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +1 Query: 550 ISGIFDALTGGNSSREAIIATRKGMVLLKQ 639 +SG+FDALTGGNS REA IA R+GM+L +Q Sbjct: 61 VSGLFDALTGGNSPREAAIAIRRGMLLFRQ 90 Score = 28.9 bits (63), Expect(2) = 9e-06 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 626 FF*NRFGEGG*QFRTDVVQNLN 691 ++ NRF EG QFR DV QN N Sbjct: 122 YYVNRFEEGAEQFRIDVAQNPN 143