BLASTX nr result
ID: Papaver27_contig00036908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00036908 (3368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605033.1| F-box/kelch-repeat protein [Medicago truncat... 63 1e-06 ref|XP_002300154.1| hypothetical protein POPTR_0001s32580g [Popu... 63 1e-06 ref|XP_003605059.1| F-box family protein [Medicago truncatula] g... 62 2e-06 >ref|XP_003605033.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355506088|gb|AES87230.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 500 Score = 62.8 bits (151), Expect = 1e-06 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 2/75 (2%) Frame = -3 Query: 642 KKATMSSLPREIEEVILLRLPVKSTLRFKCVCKLLHTLIYDPKFVKD*FSL--TNKNPRL 469 K+ T+ LP E+ IL+RLPVKS + FKCVCKL +LI DP F F L T PR+ Sbjct: 123 KQKTLPYLPHELIIQILMRLPVKSLIHFKCVCKLWFSLISDPHFANSHFQLTTTTHTPRI 182 Query: 468 LMIRNITYGSRKLWF 424 + I ++++ R + F Sbjct: 183 MCISSLSHEIRSIGF 197 >ref|XP_002300154.1| hypothetical protein POPTR_0001s32580g [Populus trichocarpa] gi|222847412|gb|EEE84959.1| hypothetical protein POPTR_0001s32580g [Populus trichocarpa] Length = 372 Score = 62.8 bits (151), Expect = 1e-06 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 5/61 (8%) Frame = -3 Query: 630 MSSLPREIEEVILLRLPVKSTLRFKCVCKLLHTLIYDPKFVKD*FSL-----TNKNPRLL 466 MS LP++I IL LPVKS LRFKCVCKL H+LI DPKFVK +NK+ RLL Sbjct: 1 MSKLPQDIMVDILTYLPVKSLLRFKCVCKLWHSLISDPKFVKSHLKTAREVNSNKSQRLL 60 Query: 465 M 463 + Sbjct: 61 L 61 >ref|XP_003605059.1| F-box family protein [Medicago truncatula] gi|355506114|gb|AES87256.1| F-box family protein [Medicago truncatula] Length = 222 Score = 61.6 bits (148), Expect = 2e-06 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 11/107 (10%) Frame = -3 Query: 711 IFSYILNTISLTNQFYPSSVLTMKKATMSS---------LPREIEEVILLRLPVKSTLRF 559 + S ++ + L ++ S + KKA S LPRE+ IL+ LPVKS +RF Sbjct: 2 VISLVVISTLLKSKIRVSRITVKKKAVEESMEKKKKTLYLPRELIIQILMWLPVKSLIRF 61 Query: 558 KCVCKLLHTLIYDPKFVKD*FSLT--NKNPRLLMIRNITYGSRKLWF 424 KCVCKL +LI DP F F LT PR++ I +++ + L+F Sbjct: 62 KCVCKLWFSLISDPHFANSHFQLTAAANTPRIMCISYLSHEIQSLYF 108