BLASTX nr result
ID: Papaver27_contig00036623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00036623 (870 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307325.2| hypothetical protein POPTR_0005s19420g, part... 59 2e-06 gb|EXC01181.1| Agamous-like MADS-box protein AGL16 [Morus notabi... 57 9e-06 >ref|XP_002307325.2| hypothetical protein POPTR_0005s19420g, partial [Populus trichocarpa] gi|550339320|gb|EEE94321.2| hypothetical protein POPTR_0005s19420g, partial [Populus trichocarpa] Length = 157 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 2/64 (3%) Frame = -3 Query: 694 LKSQVYGN--TSGANRTSLLPNVFSIEDDLNVPVHLQLSQPQQDDHASSEKATKLGYILL 521 L +VYG +GANR SLL N + ++ +VPVHLQLSQPQQ ++ + ATKLGY + Sbjct: 93 LYKKVYGTREVNGANRNSLLTNGLGMGEESHVPVHLQLSQPQQQNYDTPASATKLGYNFV 152 Query: 520 AYTS 509 TS Sbjct: 153 HTTS 156 >gb|EXC01181.1| Agamous-like MADS-box protein AGL16 [Morus notabilis] Length = 183 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 2/57 (3%) Frame = -3 Query: 694 LKSQVYG--NTSGANRTSLLPNVFSIEDDLNVPVHLQLSQPQQDDHASSEKATKLGY 530 L +VYG + +GANRT+LL + + ++ + PVHLQLSQPQQ ++ +S +ATKLGY Sbjct: 118 LYKKVYGTRDVNGANRTALLTDGLGMGENSHGPVHLQLSQPQQQNYETSTRATKLGY 174