BLASTX nr result
ID: Papaver27_contig00035802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00035802 (855 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC11734.1| hypothetical protein L484_020789 [Morus notabilis] 58 5e-06 >gb|EXC11734.1| hypothetical protein L484_020789 [Morus notabilis] Length = 211 Score = 57.8 bits (138), Expect = 5e-06 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = +2 Query: 455 WKKNMYSKGAH*PPIKSVLCNFVVYYFSLFKAPT*VTKITQKKIRSFLWSSAGGQKGCS* 634 WK + SKG I+SVL + +YY SLFK P V ++ ++ +R+FLW + G K S Sbjct: 32 WKNSFLSKGGRLTLIQSVLASIPIYYMSLFKIPNSVVEVLERVMRTFLWDNQDGSKSKSL 91 Query: 635 VNRDI---KDVEGLTIKNLQ 685 V DI K G I+NL+ Sbjct: 92 VAWDIVMSKQKGGFGIRNLK 111