BLASTX nr result
ID: Papaver27_contig00035633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00035633 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-li... 67 3e-09 ref|NP_001148698.1| LOC100282314 [Zea mays] gi|194698946|gb|ACF8... 67 3e-09 gb|EYU30461.1| hypothetical protein MIMGU_mgv1a011047mg [Mimulus... 66 6e-09 ref|XP_004983772.1| PREDICTED: methylsterol monooxygenase 1-1-li... 66 6e-09 ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-li... 66 6e-09 ref|XP_002467559.1| hypothetical protein SORBIDRAFT_01g030160 [S... 66 6e-09 ref|XP_006851841.1| hypothetical protein AMTR_s00041p00076350 [A... 65 7e-09 gb|AFK37077.1| unknown [Medicago truncatula] 65 1e-08 ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula... 65 1e-08 ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-li... 65 1e-08 ref|XP_007134847.1| hypothetical protein PHAVU_010G081300g [Phas... 65 1e-08 ref|XP_004245702.1| PREDICTED: methylsterol monooxygenase 1-1-li... 65 1e-08 ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-li... 65 1e-08 ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-li... 64 2e-08 ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citr... 64 2e-08 ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutr... 64 2e-08 ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Caps... 64 2e-08 gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis th... 64 2e-08 ref|XP_002872644.1| hypothetical protein ARALYDRAFT_911602 [Arab... 64 2e-08 gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis t... 64 2e-08 >ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Glycine max] Length = 359 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGDVD 122 QSNFASVFTYCDYIYGTDKGYRYQK L+KL+E + V+ Sbjct: 311 QSNFASVFTYCDYIYGTDKGYRYQKKILQKLKEELANGVE 350 >ref|NP_001148698.1| LOC100282314 [Zea mays] gi|194698946|gb|ACF83557.1| unknown [Zea mays] gi|195621480|gb|ACG32570.1| C-4 methylsterol oxidase [Zea mays] gi|195645132|gb|ACG42034.1| C-4 methylsterol oxidase [Zea mays] gi|414867603|tpg|DAA46160.1| TPA: c-4 methylsterol oxidase [Zea mays] Length = 301 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGD 116 QSNFASVFTYCDY+YGTDKGYR+ K YL KL++ G D Sbjct: 249 QSNFASVFTYCDYLYGTDKGYRFHKTYLAKLKDLGHND 286 >gb|EYU30461.1| hypothetical protein MIMGU_mgv1a011047mg [Mimulus guttatus] Length = 294 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGDVDGIN 131 QSNFASVFTYCDY+YGTDKGYRYQK L++ RE + +V+ N Sbjct: 249 QSNFASVFTYCDYLYGTDKGYRYQKKVLQQFREGLNNNVEQNN 291 >ref|XP_004983772.1| PREDICTED: methylsterol monooxygenase 1-1-like [Setaria italica] Length = 301 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGD 116 QSNFASVFTYCDY+YGTD+GYR+ K YL KL++ G D Sbjct: 249 QSNFASVFTYCDYLYGTDRGYRFHKAYLAKLKDLGQND 286 >ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-like [Cicer arietinum] Length = 303 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE 101 QSNFASVFTYCDYIYGTDKGYRYQK L KL+E Sbjct: 249 QSNFASVFTYCDYIYGTDKGYRYQKKILRKLKE 281 >ref|XP_002467559.1| hypothetical protein SORBIDRAFT_01g030160 [Sorghum bicolor] gi|241921413|gb|EER94557.1| hypothetical protein SORBIDRAFT_01g030160 [Sorghum bicolor] Length = 301 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGD 116 QSNFASVFTYCDY+YGTD+GYR+ K YL KL++ G D Sbjct: 249 QSNFASVFTYCDYLYGTDRGYRFHKAYLAKLKDLGQND 286 >ref|XP_006851841.1| hypothetical protein AMTR_s00041p00076350 [Amborella trichopoda] gi|548855424|gb|ERN13308.1| hypothetical protein AMTR_s00041p00076350 [Amborella trichopoda] Length = 291 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 4/43 (9%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE----AGSGDV 119 QSNFASVFTYCDYIYGTDKGYR+QK +L K+R G+G+V Sbjct: 238 QSNFASVFTYCDYIYGTDKGYRFQKEHLSKMRRRWIAEGNGEV 280 >gb|AFK37077.1| unknown [Medicago truncatula] Length = 303 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE 101 QSNFASVFTYCDYIYGTDKG+RYQK L+KL+E Sbjct: 249 QSNFASVFTYCDYIYGTDKGFRYQKKILQKLKE 281 >ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula] gi|355509852|gb|AES90994.1| Sterol-4-methyl-oxidase [Medicago truncatula] Length = 303 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE 101 QSNFASVFTYCDYIYGTDKG+RYQK L+KL+E Sbjct: 249 QSNFASVFTYCDYIYGTDKGFRYQKKILQKLKE 281 >ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum tuberosum] Length = 303 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGD 116 QSNFASVFTYCDYIYGTDKGYRYQK L++L+ A + + Sbjct: 249 QSNFASVFTYCDYIYGTDKGYRYQKKVLQQLKGASNAN 286 >ref|XP_007134847.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris] gi|561007892|gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris] Length = 302 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 6 SNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE 101 SNFASVFTYCDYIYGTDKGYRYQK L+KL+E Sbjct: 250 SNFASVFTYCDYIYGTDKGYRYQKKILQKLKE 281 >ref|XP_004245702.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum lycopersicum] Length = 296 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREAGSGD 116 QSNFASVFTYCDYIYGTDKGYRYQK L++L+ A + + Sbjct: 249 QSNFASVFTYCDYIYGTDKGYRYQKKVLQQLKGASNAN 286 >ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-like [Cucumis sativus] Length = 300 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 6 SNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE 101 SNFASVFTYCDYIYGTDKGYRYQK L+KL+E Sbjct: 250 SNFASVFTYCDYIYGTDKGYRYQKKILQKLKE 281 >ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X1 [Citrus sinensis] gi|568846931|ref|XP_006477295.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X2 [Citrus sinensis] gi|568846933|ref|XP_006477296.1| PREDICTED: methylsterol monooxygenase 1-2-like [Citrus sinensis] Length = 300 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 5/51 (9%) Frame = +3 Query: 6 SNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE--AGSGDVDG---INSKSE 143 SNFASVFTYCD++YGTDKGYRYQK L K++E GSG+ +G N KSE Sbjct: 250 SNFASVFTYCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNGGSYQNLKSE 300 >ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citrus clementina] gi|557542684|gb|ESR53662.1| hypothetical protein CICLE_v10021364mg [Citrus clementina] Length = 300 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 5/51 (9%) Frame = +3 Query: 6 SNFASVFTYCDYIYGTDKGYRYQKHYLEKLRE--AGSGDVDG---INSKSE 143 SNFASVFTYCD++YGTDKGYRYQK L K++E GSG+ +G N KSE Sbjct: 250 SNFASVFTYCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNGGSYQNLKSE 300 >ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum] gi|557097812|gb|ESQ38248.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum] Length = 298 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREA 104 QSNFASVFTYCDYIYGTDKGYR+QK LE+++E+ Sbjct: 251 QSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKES 284 >ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Capsella rubella] gi|482557042|gb|EOA21234.1| hypothetical protein CARUB_v10001581mg [Capsella rubella] Length = 298 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREA 104 QSNFASVFTYCDYIYGTDKGYR+QK LE+++E+ Sbjct: 251 QSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKES 284 >gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis thaliana] Length = 298 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREA 104 QSNFASVFTYCDYIYGTDKGYR+QK LE+++E+ Sbjct: 251 QSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKES 284 >ref|XP_002872644.1| hypothetical protein ARALYDRAFT_911602 [Arabidopsis lyrata subsp. lyrata] gi|297318481|gb|EFH48903.1| hypothetical protein ARALYDRAFT_911602 [Arabidopsis lyrata subsp. lyrata] Length = 298 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREA 104 QSNFASVFTYCDYIYGTDKGYR+QK LE+++E+ Sbjct: 251 QSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKES 284 >gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana] Length = 298 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 QSNFASVFTYCDYIYGTDKGYRYQKHYLEKLREA 104 QSNFASVFTYCDYIYGTDKGYR+QK LE+++E+ Sbjct: 251 QSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKES 284