BLASTX nr result
ID: Papaver27_contig00035541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00035541 (567 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598807.1| hypothetical protein MTR_3g021190 [Medicago ... 50 2e-07 >ref|XP_003598807.1| hypothetical protein MTR_3g021190 [Medicago truncatula] gi|355487855|gb|AES69058.1| hypothetical protein MTR_3g021190 [Medicago truncatula] Length = 160 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 27/44 (61%), Positives = 28/44 (63%) Frame = -1 Query: 408 AISLPTAEAANSGTNFLHIVPTEIGIIPPLSFNKGVRGALATNS 277 AISLPT A T L IVPT IG IPP FN GV+G ATNS Sbjct: 63 AISLPTPFIATLDTKRLQIVPTAIGCIPPSGFNNGVKGEEATNS 106 Score = 30.8 bits (68), Expect(2) = 2e-07 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 211 RRSSAMAATGPLRASTRCFVLKPSIPQDVTFG 116 +RS P AS RC+ PS+PQDV G Sbjct: 127 KRSLVTIEPSPHNASKRCWARNPSLPQDVHLG 158