BLASTX nr result
ID: Papaver27_contig00034839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00034839 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847776.1| hypothetical protein AMTR_s00162p00057050, p... 42 2e-06 >ref|XP_006847776.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella trichopoda] gi|548851077|gb|ERN09357.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella trichopoda] Length = 326 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 66 GTQILLVYEYMENGCLNRALFG 1 G Q+LL+YEYMEN CL+RALFG Sbjct: 50 GNQLLLIYEYMENSCLSRALFG 71 Score = 34.7 bits (78), Expect(2) = 2e-06 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = -2 Query: 151 LQVKQLSLESSDKGKVEFLNEVNTLSTLRHPNIISI 44 + +KQLS +S +G EF+NE+ S L+HPN++ + Sbjct: 9 IAIKQLSSKSK-QGNREFVNEIGMTSALQHPNLVKL 43