BLASTX nr result
ID: Papaver27_contig00034560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00034560 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048928.1| Transducin family protein / WD-40 repeat fam... 57 3e-06 ref|XP_007048927.1| Transducin family protein / WD-40 repeat fam... 57 3e-06 >ref|XP_007048928.1| Transducin family protein / WD-40 repeat family protein isoform 2 [Theobroma cacao] gi|590710798|ref|XP_007048929.1| Transducin family protein / WD-40 repeat family protein isoform 2 [Theobroma cacao] gi|508701189|gb|EOX93085.1| Transducin family protein / WD-40 repeat family protein isoform 2 [Theobroma cacao] gi|508701190|gb|EOX93086.1| Transducin family protein / WD-40 repeat family protein isoform 2 [Theobroma cacao] Length = 580 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = -2 Query: 347 RGTGWLLGMLPGPSRAVNCAGWKPWNLHMLVLFASEGRTVPVRGSICVSLKQKETHDNRV 168 RGTG L+ LPG S AVNC W P N HML AS+ RT+ + G +S K K+TH N + Sbjct: 515 RGTGELIEALPGHSGAVNCVSWNPANPHMLA-SASDDRTIRIWGLNNLSTKLKDTHSNGI 573 >ref|XP_007048927.1| Transducin family protein / WD-40 repeat family protein isoform 1 [Theobroma cacao] gi|508701188|gb|EOX93084.1| Transducin family protein / WD-40 repeat family protein isoform 1 [Theobroma cacao] Length = 619 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = -2 Query: 347 RGTGWLLGMLPGPSRAVNCAGWKPWNLHMLVLFASEGRTVPVRGSICVSLKQKETHDNRV 168 RGTG L+ LPG S AVNC W P N HML AS+ RT+ + G +S K K+TH N + Sbjct: 554 RGTGELIEALPGHSGAVNCVSWNPANPHMLA-SASDDRTIRIWGLNNLSTKLKDTHSNGI 612