BLASTX nr result
ID: Papaver27_contig00033290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00033290 (1153 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481146.1| PREDICTED: LOW QUALITY PROTEIN: regulatory-a... 56 3e-11 ref|XP_003632588.1| PREDICTED: regulatory-associated protein of ... 56 3e-11 ref|XP_004302528.1| PREDICTED: regulatory-associated protein of ... 56 3e-11 ref|XP_003632587.1| PREDICTED: regulatory-associated protein of ... 56 3e-11 ref|XP_004149929.1| PREDICTED: regulatory-associated protein of ... 56 3e-11 ref|XP_006429536.1| hypothetical protein CICLE_v10010918mg [Citr... 56 3e-11 ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prun... 56 3e-11 ref|XP_006429535.1| hypothetical protein CICLE_v10010918mg [Citr... 56 3e-11 ref|XP_002533827.1| Regulatory-associated protein of mTOR, putat... 56 3e-11 ref|XP_002531312.1| conserved hypothetical protein [Ricinus comm... 56 3e-11 ref|XP_003533671.1| PREDICTED: regulatory-associated protein of ... 56 4e-11 ref|XP_007140148.1| hypothetical protein PHAVU_008G087800g [Phas... 56 4e-11 ref|XP_003551595.1| PREDICTED: regulatory-associated protein of ... 56 4e-11 ref|XP_006602692.1| PREDICTED: regulatory-associated protein of ... 56 4e-11 ref|XP_006602693.1| PREDICTED: regulatory-associated protein of ... 56 4e-11 ref|XP_006602694.1| PREDICTED: regulatory-associated protein of ... 56 4e-11 ref|XP_006602695.1| PREDICTED: regulatory-associated protein of ... 56 4e-11 ref|XP_002309174.1| transducin family protein [Populus trichocar... 55 7e-11 ref|XP_002323654.1| transducin family protein [Populus trichocar... 55 7e-11 ref|XP_003623550.1| Regulatory-associated protein of mTOR [Medic... 56 9e-11 >ref|XP_006481146.1| PREDICTED: LOW QUALITY PROTEIN: regulatory-associated protein of TOR 1-like [Citrus sinensis] Length = 1374 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 354 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 387 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 391 CSPISHPMLPPTHQHHM 407 >ref|XP_003632588.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform 2 [Vitis vinifera] Length = 1370 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 350 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 383 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 387 CSPISHPMLPPTHQHHM 403 >ref|XP_004302528.1| PREDICTED: regulatory-associated protein of TOR 1-like [Fragaria vesca subsp. vesca] Length = 1365 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 348 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 381 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHP LPS HQHHM Sbjct: 385 CSPISHPQLPSTHQHHM 401 >ref|XP_003632587.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform 1 [Vitis vinifera] gi|297735579|emb|CBI18073.3| unnamed protein product [Vitis vinifera] Length = 1363 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 350 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 383 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 387 CSPISHPMLPPTHQHHM 403 >ref|XP_004149929.1| PREDICTED: regulatory-associated protein of TOR 1-like [Cucumis sativus] gi|449517611|ref|XP_004165839.1| PREDICTED: regulatory-associated protein of TOR 1-like [Cucumis sativus] Length = 1362 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 349 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 382 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 386 CSPISHPMLPPTHQHHM 402 >ref|XP_006429536.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] gi|557531593|gb|ESR42776.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] Length = 1348 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 354 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 387 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 391 CSPISHPMLPPTHQHHM 407 >ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] gi|462404033|gb|EMJ09590.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] Length = 1346 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 352 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 385 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 389 CSPISHPMLPPTHQHHM 405 >ref|XP_006429535.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] gi|557531592|gb|ESR42775.1| hypothetical protein CICLE_v10010918mg [Citrus clementina] Length = 1256 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 354 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 387 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 391 CSPISHPMLPPTHQHHM 407 >ref|XP_002533827.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] gi|223526244|gb|EEF28562.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] Length = 1221 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 35/81 (43%), Positives = 43/81 (53%) Frame = +2 Query: 857 YRCMYTRSRILRVWLRHQNARGRPCLCFA*REVHHGIISKSFCWFRDWDSSA*DLFQRLF 1036 ++ Y R L+V L N PC +++ + W + LFQRLF Sbjct: 185 HKLAYYEERQLKVHLASLN----PCF----------LLTHEYVQTNMWQNKVFHLFQRLF 230 Query: 1037 RQDLLVASLFRNFLFAERIMR 1099 RQDLLVASLFRNFL AERIMR Sbjct: 231 RQDLLVASLFRNFLLAERIMR 251 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 255 CSPISHPMLPPTHQHHM 271 >ref|XP_002531312.1| conserved hypothetical protein [Ricinus communis] gi|223529080|gb|EEF31062.1| conserved hypothetical protein [Ricinus communis] Length = 1108 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 432 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 465 Score = 39.7 bits (91), Expect(2) = 3e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 469 CSPISHPMLPPTHQHHM 485 >ref|XP_003533671.1| PREDICTED: regulatory-associated protein of TOR 1-like [Glycine max] Length = 1373 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 375 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 408 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 412 CSPVSHPMLPPTHQHHM 428 >ref|XP_007140148.1| hypothetical protein PHAVU_008G087800g [Phaseolus vulgaris] gi|561013281|gb|ESW12142.1| hypothetical protein PHAVU_008G087800g [Phaseolus vulgaris] Length = 1370 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 368 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 401 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 405 CSPVSHPMLPPTHQHHM 421 >ref|XP_003551595.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Glycine max] Length = 1365 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 367 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 400 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 404 CSPVSHPMLPPTHQHHM 420 >ref|XP_006602692.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X2 [Glycine max] Length = 1312 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 367 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 400 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 404 CSPVSHPMLPPTHQHHM 420 >ref|XP_006602693.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X3 [Glycine max] Length = 1258 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 260 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 293 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 297 CSPVSHPMLPPTHQHHM 313 >ref|XP_006602694.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X4 [Glycine max] Length = 1146 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 148 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 181 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 185 CSPVSHPMLPPTHQHHM 201 >ref|XP_006602695.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X5 [Glycine max] Length = 1105 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 107 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 140 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSP+SHPMLP HQHHM Sbjct: 144 CSPVSHPMLPPTHQHHM 160 >ref|XP_002309174.1| transducin family protein [Populus trichocarpa] gi|222855150|gb|EEE92697.1| transducin family protein [Populus trichocarpa] Length = 1377 Score = 55.1 bits (131), Expect(2) = 7e-11 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQ+LFRQDLLVASLFRNFL AERIMR Sbjct: 372 WNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMR 405 Score = 39.7 bits (91), Expect(2) = 7e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 409 CSPISHPMLPPTHQHHM 425 >ref|XP_002323654.1| transducin family protein [Populus trichocarpa] gi|222868284|gb|EEF05415.1| transducin family protein [Populus trichocarpa] Length = 1366 Score = 55.1 bits (131), Expect(2) = 7e-11 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQ+LFRQDLLVASLFRNFL AERIMR Sbjct: 350 WNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMR 383 Score = 39.7 bits (91), Expect(2) = 7e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 CSPISHPMLP HQHHM Sbjct: 387 CSPISHPMLPPTHQHHM 403 >ref|XP_003623550.1| Regulatory-associated protein of mTOR [Medicago truncatula] gi|355498565|gb|AES79768.1| Regulatory-associated protein of mTOR [Medicago truncatula] Length = 1430 Score = 56.2 bits (134), Expect(2) = 9e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 998 WDSSA*DLFQRLFRQDLLVASLFRNFLFAERIMR 1099 W+ DLFQRLFRQDLLVASLFRNFL AERIMR Sbjct: 374 WNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMR 407 Score = 38.1 bits (87), Expect(2) = 9e-11 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 1101 CSPISHPMLPSIHQHHM 1151 C+P+SHPMLP HQHHM Sbjct: 411 CTPVSHPMLPPTHQHHM 427