BLASTX nr result
ID: Papaver27_contig00031425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00031425 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528094.1| translation initiation factor if-2, putative... 56 5e-06 ref|XP_006473040.1| PREDICTED: eukaryotic translation initiation... 56 6e-06 ref|XP_006434442.1| hypothetical protein CICLE_v10000034mg [Citr... 56 6e-06 ref|XP_007199680.1| hypothetical protein PRUPE_ppa000257mg [Prun... 56 6e-06 ref|XP_004154455.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 56 6e-06 ref|XP_004139637.1| PREDICTED: uncharacterized protein LOC101204... 56 6e-06 >ref|XP_002528094.1| translation initiation factor if-2, putative [Ricinus communis] gi|223532483|gb|EEF34273.1| translation initiation factor if-2, putative [Ricinus communis] Length = 1263 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 393 SIDILKANYREDLSIDEWRLVVKLKRLFDIQ 301 SID+LKANYR+DLS+DEWRLVVKLK +F IQ Sbjct: 1233 SIDVLKANYRDDLSMDEWRLVVKLKNIFKIQ 1263 >ref|XP_006473040.1| PREDICTED: eukaryotic translation initiation factor 5B-like isoform X1 [Citrus sinensis] gi|568838072|ref|XP_006473041.1| PREDICTED: eukaryotic translation initiation factor 5B-like isoform X2 [Citrus sinensis] Length = 1385 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 393 SIDILKANYREDLSIDEWRLVVKLKRLFDIQ 301 SID+LKANYR+DLS+DEWRL+VKLK LF IQ Sbjct: 1355 SIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ 1385 >ref|XP_006434442.1| hypothetical protein CICLE_v10000034mg [Citrus clementina] gi|557536564|gb|ESR47682.1| hypothetical protein CICLE_v10000034mg [Citrus clementina] Length = 1384 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 393 SIDILKANYREDLSIDEWRLVVKLKRLFDIQ 301 SID+LKANYR+DLS+DEWRL+VKLK LF IQ Sbjct: 1354 SIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ 1384 >ref|XP_007199680.1| hypothetical protein PRUPE_ppa000257mg [Prunus persica] gi|462395080|gb|EMJ00879.1| hypothetical protein PRUPE_ppa000257mg [Prunus persica] Length = 1381 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 393 SIDILKANYREDLSIDEWRLVVKLKRLFDI 304 SIDILKANYR++LSIDEW+LVVKLK+LF+I Sbjct: 1351 SIDILKANYRDELSIDEWKLVVKLKKLFEI 1380 >ref|XP_004154455.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204360 [Cucumis sativus] Length = 1370 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 393 SIDILKANYREDLSIDEWRLVVKLKRLFDIQ 301 SID+LKANYR+DLS DEWRLVVKLK LF IQ Sbjct: 1340 SIDLLKANYRDDLSTDEWRLVVKLKNLFKIQ 1370 >ref|XP_004139637.1| PREDICTED: uncharacterized protein LOC101204360 [Cucumis sativus] Length = 1370 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 393 SIDILKANYREDLSIDEWRLVVKLKRLFDIQ 301 SID+LKANYR+DLS DEWRLVVKLK LF IQ Sbjct: 1340 SIDLLKANYRDDLSTDEWRLVVKLKNLFKIQ 1370