BLASTX nr result
ID: Papaver27_contig00029856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00029856 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230818.1| PREDICTED: cyclin-dependent kinase inhibitor... 82 1e-13 ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor... 78 1e-12 emb|CBI21439.3| unnamed protein product [Vitis vinifera] 78 1e-12 ref|XP_006346465.1| PREDICTED: cyclin-dependent kinase inhibitor... 77 2e-12 gb|AFK38333.1| unknown [Lotus japonicus] 77 2e-12 gb|EXB55911.1| Cyclin-dependent kinase inhibitor 7 [Morus notabi... 77 3e-12 ref|XP_007155934.1| hypothetical protein PHAVU_003G244700g [Phas... 75 9e-12 gb|EYU39335.1| hypothetical protein MIMGU_mgv1a014302mg [Mimulus... 75 1e-11 dbj|BAB20860.1| cyclin dependent kinase inhibitor [Pisum sativum] 75 1e-11 emb|CAC41621.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis... 74 2e-11 ref|NP_175385.1| cyclin-dependent kinase inhibitor 7 [Arabidopsi... 74 2e-11 ref|XP_002523560.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_006393233.1| hypothetical protein EUTSA_v10011789mg [Eutr... 74 3e-11 ref|XP_003611764.1| Cyclin dependent kinase inhibitor [Medicago ... 73 4e-11 ref|XP_002518785.1| conserved hypothetical protein [Ricinus comm... 73 4e-11 ref|XP_006305579.1| hypothetical protein CARUB_v10010232mg, part... 73 5e-11 ref|XP_003524631.1| PREDICTED: cyclin-dependent kinase inhibitor... 73 5e-11 ref|XP_002894202.1| hypothetical protein ARALYDRAFT_474096 [Arab... 73 5e-11 gb|ACU19223.1| unknown [Glycine max] 73 5e-11 ref|XP_002313108.2| cyclin dependent kinase inhibitor family pro... 72 6e-11 >ref|XP_004230818.1| PREDICTED: cyclin-dependent kinase inhibitor 6-like [Solanum lycopersicum] Length = 222 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/58 (62%), Positives = 46/58 (79%) Frame = -3 Query: 426 SEANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 S A++ ++LS K+P E EI++FFSA EK+E KRF EKYNYDI KD PLEGRY+W+S Sbjct: 157 SSASAPRKQLSASKVPPEAEIEEFFSAAEKREQKRFAEKYNYDIVKDAPLEGRYQWVS 214 >ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Vitis vinifera] Length = 227 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -3 Query: 426 SEANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 SEAN + R + EKMP+E+E+++FF+A EK KRF EKYNYDI KDVP+EGRYEW+ Sbjct: 168 SEANYRHRS-TVEKMPSESELEEFFAAAEKDVQKRFSEKYNYDIVKDVPMEGRYEWV 223 >emb|CBI21439.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = -3 Query: 426 SEANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 SEAN + R + EKMP+E+E+++FF+A EK KRF EKYNYDI KDVP+EGRYEW+ Sbjct: 153 SEANYRHRS-TVEKMPSESELEEFFAAAEKDVQKRFSEKYNYDIVKDVPMEGRYEWV 208 >ref|XP_006346465.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Solanum tuberosum] Length = 199 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -3 Query: 426 SEANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 S A++ ++ S K+P E EI++FFSA EK E KRF EKYNYDI KD PLEGRY+W+S Sbjct: 139 SSASALRKQPSASKVPPEAEIEEFFSAAEKCEQKRFAEKYNYDIVKDAPLEGRYQWVS 196 >gb|AFK38333.1| unknown [Lotus japonicus] Length = 193 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 E +S K +KMPTE+E+++FFSA EK KRF KYNYDI KDVPLEGRYEW+ Sbjct: 134 EVDSVEEKEKLQKMPTESELEEFFSAAEKDIQKRFSHKYNYDIVKDVPLEGRYEWV 189 >gb|EXB55911.1| Cyclin-dependent kinase inhibitor 7 [Morus notabilis] Length = 251 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = -3 Query: 417 NSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 +S SR EKMP+E+E+++FF+A EK KRF EKYNYDI KD PLEGRYEW+ Sbjct: 194 DSHSRSAVAEKMPSESELEEFFAAAEKDIQKRFAEKYNYDIVKDTPLEGRYEWL 247 >ref|XP_007155934.1| hypothetical protein PHAVU_003G244700g [Phaseolus vulgaris] gi|561029288|gb|ESW27928.1| hypothetical protein PHAVU_003G244700g [Phaseolus vulgaris] Length = 191 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 390 EKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 +K PT++E+++FF+A EK HKRF EKYNYDI KDVPLEGRYEW+ Sbjct: 143 QKRPTDSELEEFFAAAEKDIHKRFSEKYNYDIVKDVPLEGRYEWV 187 >gb|EYU39335.1| hypothetical protein MIMGU_mgv1a014302mg [Mimulus guttatus] Length = 194 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 E +++ R + EKMP+E E+++FF+A E HK+F KYNYDI KD PLEGRYEW+ Sbjct: 133 ETSNRRRSTAAEKMPSEAELEEFFAAAENNLHKQFTNKYNYDIVKDQPLEGRYEWV 188 >dbj|BAB20860.1| cyclin dependent kinase inhibitor [Pisum sativum] Length = 192 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 E NS+ S +K PTE E+++FF+A EK K+F EKYNYDI KDVPLEGRYEW+ Sbjct: 133 ETNSRRPISSPKKTPTEYELEEFFAAAEKDIQKKFQEKYNYDILKDVPLEGRYEWV 188 >emb|CAC41621.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] Length = 195 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -3 Query: 405 RKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 +K EK PT+ E+ DFFSA E+ E KRF EKYNYDI D PLEGRY+W+S Sbjct: 142 KKKKMEKSPTQAELDDFFSAAERYEQKRFTEKYNYDIVNDTPLEGRYQWVS 192 >ref|NP_175385.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] gi|152032531|sp|Q94CL9.2|KRP7_ARATH RecName: Full=Cyclin-dependent kinase inhibitor 7; AltName: Full=Inhibitor/interactor of CDK protein 5; AltName: Full=KIP-related protein 7 gi|10120423|gb|AAG13048.1|AC011807_7 Hypothetical protein [Arabidopsis thaliana] gi|332194329|gb|AEE32450.1| cyclin-dependent kinase inhibitor 7 [Arabidopsis thaliana] Length = 195 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -3 Query: 405 RKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 +K EK PT+ E+ DFFSA E+ E KRF EKYNYDI D PLEGRY+W+S Sbjct: 142 KKKKMEKSPTQAELDDFFSAAERYEQKRFTEKYNYDIVNDTPLEGRYQWVS 192 >ref|XP_002523560.1| conserved hypothetical protein [Ricinus communis] gi|223537122|gb|EEF38755.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 423 EANSKSR-KLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 EANS+ + L+ EKMPTETE+ +FF+ E+ KRF +KYNYD+ KD PL+GRYEW+ Sbjct: 159 EANSRRKPSLTVEKMPTETELDEFFAEAERNIQKRFADKYNYDVVKDEPLKGRYEWV 215 >ref|XP_006393233.1| hypothetical protein EUTSA_v10011789mg [Eutrema salsugineum] gi|557089811|gb|ESQ30519.1| hypothetical protein EUTSA_v10011789mg [Eutrema salsugineum] Length = 201 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = -3 Query: 411 KSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 K RK + EK PT+ E+ DFFSA E+ E KRF EKYNYDI D PLEGRY+W+S Sbjct: 147 KERKKT-EKSPTQAELDDFFSAAERFEQKRFTEKYNYDIVNDTPLEGRYQWVS 198 >ref|XP_003611764.1| Cyclin dependent kinase inhibitor [Medicago truncatula] gi|355513099|gb|AES94722.1| Cyclin dependent kinase inhibitor [Medicago truncatula] Length = 183 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 E NS S + MPT E+++FFSA EK K+F EKYNYDI KDVPLEGRYEW+ Sbjct: 124 ETNSNRPISSPKNMPTGFELEEFFSAAEKNIQKKFQEKYNYDIVKDVPLEGRYEWV 179 >ref|XP_002518785.1| conserved hypothetical protein [Ricinus communis] gi|223542166|gb|EEF43710.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = -3 Query: 417 NSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 N + +L EK+P++ EI +FF+ EK+E KRF +KYNYDI KD+PLEGRY+W+ Sbjct: 145 NCRKIRLPAEKVPSQVEIDEFFAEAEKKEQKRFADKYNYDIVKDLPLEGRYQWV 198 >ref|XP_006305579.1| hypothetical protein CARUB_v10010232mg, partial [Capsella rubella] gi|482574290|gb|EOA38477.1| hypothetical protein CARUB_v10010232mg, partial [Capsella rubella] Length = 225 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/57 (57%), Positives = 42/57 (73%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 +A K++K+ K PT+ EI DFFSA E+ + KRF EKYNYDI D PLEGRY+W+S Sbjct: 168 KAEMKTKKMG--KSPTQAEIDDFFSAAERFDQKRFTEKYNYDIVNDTPLEGRYQWVS 222 >ref|XP_003524631.1| PREDICTED: cyclin-dependent kinase inhibitor 7 [Glycine max] Length = 184 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 E ++++ L +KMPTE E+ +FF+A EK KRF +KYNYDI KDV LEGRYEW+ Sbjct: 125 EQITQTKSLPPQKMPTELELDEFFAAAEKDIRKRFSDKYNYDIVKDVSLEGRYEWV 180 >ref|XP_002894202.1| hypothetical protein ARALYDRAFT_474096 [Arabidopsis lyrata subsp. lyrata] gi|297340044|gb|EFH70461.1| hypothetical protein ARALYDRAFT_474096 [Arabidopsis lyrata subsp. lyrata] Length = 195 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -3 Query: 390 EKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWIS 253 EK PT+ E+ DFFSA E+ E KRF EKYNYDI D PLEGRY+W+S Sbjct: 147 EKSPTQAELDDFFSAAERFEQKRFTEKYNYDIVNDTPLEGRYQWVS 192 >gb|ACU19223.1| unknown [Glycine max] Length = 184 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -3 Query: 423 EANSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 E ++++ L +KMPTE E+ +FF+A EK KRF +KYNYDI KDV LEGRYEW+ Sbjct: 125 EQITQTKSLPPQKMPTELELDEFFAAAEKDIRKRFSDKYNYDIVKDVSLEGRYEWV 180 >ref|XP_002313108.2| cyclin dependent kinase inhibitor family protein [Populus trichocarpa] gi|550331464|gb|EEE87063.2| cyclin dependent kinase inhibitor family protein [Populus trichocarpa] Length = 206 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -3 Query: 417 NSKSRKLSDEKMPTETEIKDFFSAFEKQEHKRFLEKYNYDITKDVPLEGRYEWI 256 NS RK KMP++ EI FF+ E++E KRF EKYNYD+ KD+P+EGRY+WI Sbjct: 143 NSHRRKSPAVKMPSQAEIDAFFAGAEREEQKRFAEKYNYDVVKDLPVEGRYQWI 196