BLASTX nr result
ID: Papaver27_contig00028216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00028216 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847574.1| hypothetical protein AMTR_s00014p00221370 [A... 56 5e-06 >ref|XP_006847574.1| hypothetical protein AMTR_s00014p00221370 [Amborella trichopoda] gi|548850808|gb|ERN09155.1| hypothetical protein AMTR_s00014p00221370 [Amborella trichopoda] Length = 1014 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 5/61 (8%) Frame = +2 Query: 197 ESNSGEGQGAG-----GTYSAVGFSYGNSDVSADQKNSDSVVGDYGFRPPFPVPENLLQS 361 +S+ EG G G G+Y AV FSYGN++ S+D +NS+ G F PPFP+PE L+ Sbjct: 110 KSDDPEGGGRGAEMASGSYQAVPFSYGNTEASSDPRNSEERFGKSNFCPPFPMPETLVNH 169 Query: 362 L 364 L Sbjct: 170 L 170