BLASTX nr result
ID: Papaver27_contig00028213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00028213 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006579589.1| PREDICTED: programmed cell death protein 4-l... 57 3e-06 >ref|XP_006579589.1| PREDICTED: programmed cell death protein 4-like [Glycine max] Length = 639 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 359 TRIRXXXXXXXXDIPNAEEKFGFYVEHAKKNGWLLPSFTAYAS 231 TRI+ DIPNA+EKFGFYVEHA+ NGWLLPSF + A+ Sbjct: 595 TRIKDGLDDLALDIPNAKEKFGFYVEHAQSNGWLLPSFDSPAT 637