BLASTX nr result
ID: Papaver27_contig00027786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00027786 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006404566.1| hypothetical protein EUTSA_v10000256mg [Eutr... 76 6e-12 ref|XP_006294649.1| hypothetical protein CARUB_v10023686mg [Caps... 74 2e-11 ref|XP_002880370.1| hypothetical protein ARALYDRAFT_480985 [Arab... 74 2e-11 gb|AFO63538.1| NADPH-dependent mannose-6-phosphate reductase [Go... 73 4e-11 ref|XP_006487264.1| PREDICTED: NADP-dependent D-sorbitol-6-phosp... 73 5e-11 ref|XP_006423506.1| hypothetical protein CICLE_v10028892mg [Citr... 73 5e-11 ref|XP_007220526.1| hypothetical protein PRUPE_ppa009027mg [Prun... 72 8e-11 ref|XP_007042015.1| NAD(P)-linked oxidoreductase superfamily pro... 71 1e-10 ref|XP_003607080.1| NADP-dependent D-sorbitol-6-phosphate dehydr... 71 2e-10 ref|NP_179721.1| putative NADPH dependent mannose 6-phosphate re... 70 2e-10 ref|XP_006359603.1| PREDICTED: NADP-dependent D-sorbitol-6-phosp... 70 3e-10 ref|NP_001240166.1| uncharacterized protein LOC100806500 [Glycin... 70 4e-10 gb|EXB61822.1| NADP-dependent D-sorbitol-6-phosphate dehydrogena... 69 5e-10 ref|XP_004952056.1| PREDICTED: NADP-dependent D-sorbitol-6-phosp... 69 5e-10 ref|XP_004148544.1| PREDICTED: NADP-dependent D-sorbitol-6-phosp... 68 1e-09 ref|XP_002513006.1| aldo-keto reductase, putative [Ricinus commu... 68 1e-09 ref|XP_002313755.1| NADP dependent sorbitol 6-phosphate dehydrog... 68 1e-09 gb|AAG15839.2|AF055910_1 NADPH-dependent mannose 6-phosphate red... 68 1e-09 ref|XP_002880371.1| hypothetical protein ARALYDRAFT_480986 [Arab... 68 1e-09 ref|XP_002453228.1| hypothetical protein SORBIDRAFT_04g001950 [S... 68 1e-09 >ref|XP_006404566.1| hypothetical protein EUTSA_v10000256mg [Eutrema salsugineum] gi|557105694|gb|ESQ46019.1| hypothetical protein EUTSA_v10000256mg [Eutrema salsugineum] Length = 309 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFELTKEDME IK++DRKYRTNQPAKFWG+DLYA Sbjct: 272 FQVFDFELTKEDMEVIKSMDRKYRTNQPAKFWGIDLYA 309 >ref|XP_006294649.1| hypothetical protein CARUB_v10023686mg [Capsella rubella] gi|482563357|gb|EOA27547.1| hypothetical protein CARUB_v10023686mg [Capsella rubella] Length = 309 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDME IK++DRKYRTNQPAKFWG+DLYA Sbjct: 272 FQVFDFELSKEDMELIKSMDRKYRTNQPAKFWGIDLYA 309 >ref|XP_002880370.1| hypothetical protein ARALYDRAFT_480985 [Arabidopsis lyrata subsp. lyrata] gi|297326209|gb|EFH56629.1| hypothetical protein ARALYDRAFT_480985 [Arabidopsis lyrata subsp. lyrata] Length = 309 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDME IK++DRKYRTNQPAKFWG+DLYA Sbjct: 272 FQVFDFELSKEDMEVIKSMDRKYRTNQPAKFWGIDLYA 309 >gb|AFO63538.1| NADPH-dependent mannose-6-phosphate reductase [Gossypium hirsutum] Length = 309 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL KEDM+ IK +DRKYRTNQPAKFWG+DLYA Sbjct: 272 FEVFDFELAKEDMDKIKAIDRKYRTNQPAKFWGIDLYA 309 >ref|XP_006487264.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Citrus sinensis] Length = 309 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 FKVFDFEL+KEDM+ IK++DRKYRTNQPA+FWG+DL+A Sbjct: 272 FKVFDFELSKEDMDVIKSIDRKYRTNQPARFWGIDLFA 309 >ref|XP_006423506.1| hypothetical protein CICLE_v10028892mg [Citrus clementina] gi|557525440|gb|ESR36746.1| hypothetical protein CICLE_v10028892mg [Citrus clementina] Length = 309 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 FKVFDFEL+KEDM+ IK++DRKYRTNQPA+FWG+DL+A Sbjct: 272 FKVFDFELSKEDMDVIKSIDRKYRTNQPARFWGIDLFA 309 >ref|XP_007220526.1| hypothetical protein PRUPE_ppa009027mg [Prunus persica] gi|462416988|gb|EMJ21725.1| hypothetical protein PRUPE_ppa009027mg [Prunus persica] Length = 309 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFELTKE+M+ IK VDRK+RTNQPAKFWG+DLYA Sbjct: 272 FQVFDFELTKEEMDLIKKVDRKHRTNQPAKFWGIDLYA 309 >ref|XP_007042015.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao] gi|508705950|gb|EOX97846.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao] Length = 309 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL KEDM+ I+ VDRKYRTNQPA+FWG+DLYA Sbjct: 272 FQVFDFELAKEDMDLIRTVDRKYRTNQPARFWGIDLYA 309 >ref|XP_003607080.1| NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Medicago truncatula] gi|355508135|gb|AES89277.1| NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Medicago truncatula] gi|388507144|gb|AFK41638.1| unknown [Medicago truncatula] Length = 309 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDME I ++DR+YRTNQPAKFWG+DLYA Sbjct: 272 FQVFDFELSKEDMELISSMDREYRTNQPAKFWGIDLYA 309 >ref|NP_179721.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|4567260|gb|AAD23673.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|20198119|gb|AAM15409.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|20260680|gb|AAM13238.1| putative NADPH-dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|24899831|gb|AAN65130.1| putative NADPH-dependent mannose 6-phosphate reductase [Arabidopsis thaliana] gi|330252056|gb|AEC07150.1| putative NADPH dependent mannose 6-phosphate reductase [Arabidopsis thaliana] Length = 309 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDME IK+++RKYRTNQPAKFW +DLYA Sbjct: 272 FQVFDFELSKEDMEVIKSMERKYRTNQPAKFWNIDLYA 309 >ref|XP_006359603.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Solanum tuberosum] Length = 309 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F V DFELTKEDM+ IK++DR YRTNQPAKFWG+DLYA Sbjct: 272 FNVLDFELTKEDMDLIKSLDRNYRTNQPAKFWGIDLYA 309 >ref|NP_001240166.1| uncharacterized protein LOC100806500 [Glycine max] gi|255646011|gb|ACU23493.1| unknown [Glycine max] Length = 309 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDME I ++DRKYRTNQPA FWG+DLYA Sbjct: 272 FQVFDFELSKEDMELIGSIDRKYRTNQPAVFWGIDLYA 309 >gb|EXB61822.1| NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Morus notabilis] Length = 313 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFELTKEDM+ IK VD+K+RTNQPAK WG+DLYA Sbjct: 276 FEVFDFELTKEDMDLIKTVDKKHRTNQPAKLWGMDLYA 313 >ref|XP_004952056.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Setaria italica] Length = 316 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFE++ EDME IK +DR YRTNQPAKFWG+DLYA Sbjct: 279 FEVFDFEISGEDMEKIKAIDRSYRTNQPAKFWGIDLYA 316 >ref|XP_004148544.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Cucumis sativus] gi|449521003|ref|XP_004167521.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Cucumis sativus] Length = 309 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDF++ KEDM+ I +DRKYRTNQPA+FWG+DLYA Sbjct: 272 FQVFDFQIVKEDMDLINGIDRKYRTNQPARFWGIDLYA 309 >ref|XP_002513006.1| aldo-keto reductase, putative [Ricinus communis] gi|223548017|gb|EEF49509.1| aldo-keto reductase, putative [Ricinus communis] Length = 309 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +3 Query: 6 KVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 +VFDFEL+KEDM+ IK++DR YRTNQPAKFWGV+LYA Sbjct: 273 EVFDFELSKEDMDLIKSIDRSYRTNQPAKFWGVNLYA 309 >ref|XP_002313755.1| NADP dependent sorbitol 6-phosphate dehydrogenase family protein [Populus trichocarpa] gi|222850163|gb|EEE87710.1| NADP dependent sorbitol 6-phosphate dehydrogenase family protein [Populus trichocarpa] Length = 309 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDM+ +K +DR YRTNQPAKFWG++LYA Sbjct: 272 FEVFDFELSKEDMDLLKELDRNYRTNQPAKFWGINLYA 309 >gb|AAG15839.2|AF055910_1 NADPH-dependent mannose 6-phosphate reductase [Orobanche ramosa] Length = 310 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+ EDME +K ++RKYRTNQPAKFWG+DL+A Sbjct: 273 FQVFDFELSNEDMELLKTMERKYRTNQPAKFWGIDLFA 310 >ref|XP_002880371.1| hypothetical protein ARALYDRAFT_480986 [Arabidopsis lyrata subsp. lyrata] gi|297326210|gb|EFH56630.1| hypothetical protein ARALYDRAFT_480986 [Arabidopsis lyrata subsp. lyrata] Length = 309 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDFEL+KEDME IK++DRKYRT+Q AKFWG++LYA Sbjct: 272 FQVFDFELSKEDMEVIKSMDRKYRTHQTAKFWGIELYA 309 >ref|XP_002453228.1| hypothetical protein SORBIDRAFT_04g001950 [Sorghum bicolor] gi|241933059|gb|EES06204.1| hypothetical protein SORBIDRAFT_04g001950 [Sorghum bicolor] gi|300681323|emb|CAZ96043.1| NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Sorghum bicolor] Length = 318 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 3 FKVFDFELTKEDMESIKNVDRKYRTNQPAKFWGVDLYA 116 F+VFDF+++ EDME +K VDRKYRTNQPAKFWG+DL+A Sbjct: 281 FEVFDFDISGEDMEKMKAVDRKYRTNQPAKFWGIDLFA 318