BLASTX nr result
ID: Papaver27_contig00023738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00023738 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202497.1| hypothetical protein PRUPE_ppa010661mg [Prun... 58 2e-06 ref|XP_006442040.1| hypothetical protein CICLE_v10024361mg [Citr... 56 4e-06 >ref|XP_007202497.1| hypothetical protein PRUPE_ppa010661mg [Prunus persica] gi|462398028|gb|EMJ03696.1| hypothetical protein PRUPE_ppa010661mg [Prunus persica] Length = 241 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 447 HPRGFKATSIIDNELAVGRRRGNEKLGRWKRCL 349 HP GFKATSI+DNELAV R+G EKLGRWKR L Sbjct: 204 HPMGFKATSIVDNELAVPPRKGREKLGRWKRSL 236 >ref|XP_006442040.1| hypothetical protein CICLE_v10024361mg [Citrus clementina] gi|557544302|gb|ESR55280.1| hypothetical protein CICLE_v10024361mg [Citrus clementina] Length = 231 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 447 HPRGFKATSIIDNELAVGRRRGNEKLGRWKR 355 HP GF+ATSI+DN+LA+G R+G EKLGRWKR Sbjct: 194 HPMGFQATSIVDNKLAIGPRKGREKLGRWKR 224