BLASTX nr result
ID: Papaver27_contig00023563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00023563 (520 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200229.1| hypothetical protein PRUPE_ppa015297mg [Prun... 59 7e-07 >ref|XP_007200229.1| hypothetical protein PRUPE_ppa015297mg [Prunus persica] gi|462395629|gb|EMJ01428.1| hypothetical protein PRUPE_ppa015297mg [Prunus persica] Length = 435 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/74 (37%), Positives = 43/74 (58%) Frame = -2 Query: 240 QNLHLEGDCLNVVNAINGSLGSVKWTNNNVIQDCRSLL*SFTSCKCTFVHRESNEVANNL 61 Q + E DCL V +ING + KW ++ + R L +F SC T++ R +NE A++L Sbjct: 337 QLVSFEFDCLEAVKSINGDISRGKWEIYPILSNIRDFLLAFRSCSWTWIRRIANEAADHL 396 Query: 60 AKQAKNLRSNEYWS 19 A+ AK+ NE W+ Sbjct: 397 AQLAKSRMCNEVWA 410