BLASTX nr result
ID: Papaver27_contig00023404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00023404 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena le... 126 3e-27 gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica] 126 3e-27 ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Caps... 126 4e-27 gb|AFP86474.1| phenylalanine ammonia-lyase, partial [Brassica ra... 126 4e-27 ref|XP_002862326.1| predicted protein [Arabidopsis lyrata subsp.... 126 4e-27 gb|ABC69917.1| phenylalanine ammonia-lyase [Brassica napus] 126 4e-27 gb|AAC18871.1| phenylalanine ammonia lyase [Arabidopsis thaliana] 125 5e-27 ref|NP_190894.1| phenylalanine ammonia-lyase 2 [Arabidopsis thal... 125 5e-27 dbj|BAH20339.1| AT3G53260 [Arabidopsis thaliana] 125 5e-27 gb|AAM12956.1| phenylalanine ammonia-lyase [Arabidopsis thaliana... 125 5e-27 gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot ... 125 5e-27 gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus] 125 6e-27 gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana] 125 6e-27 ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thal... 125 6e-27 ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arab... 125 6e-27 ref|XP_002877909.1| phenylalanine ammonia-lyase 2 [Arabidopsis l... 125 6e-27 dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana] 125 6e-27 dbj|BAD95069.1| phenylalanine ammonia lyase [Arabidopsis thaliana] 125 6e-27 gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot ... 125 6e-27 sp|P45727.1|PALY_PERAE RecName: Full=Phenylalanine ammonia-lyase... 125 8e-27 >gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala] Length = 365 Score = 126 bits (317), Expect = 3e-27 Identities = 57/64 (89%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL TGLLTGEKV SPGEEFDKVFTA+CEGK+IDPLL+CLK WNGAP Sbjct: 302 KECRSYPLYRFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAP 361 Query: 181 LPIC 192 LP+C Sbjct: 362 LPLC 365 >gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica] Length = 706 Score = 126 bits (317), Expect = 3e-27 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 K+CRSYPLY+FVREEL TG LTGEK+ SPGEEFDKVFTAIC GKMIDPLL+CLKEWNGAP Sbjct: 643 KDCRSYPLYKFVREELGTGFLTGEKIVSPGEEFDKVFTAICNGKMIDPLLDCLKEWNGAP 702 Query: 181 LPIC 192 LPIC Sbjct: 703 LPIC 706 >ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella] gi|482562469|gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella] Length = 726 Score = 126 bits (316), Expect = 4e-27 Identities = 57/64 (89%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP++ CL EWNGAP Sbjct: 663 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAP 722 Query: 181 LPIC 192 LPIC Sbjct: 723 LPIC 726 >gb|AFP86474.1| phenylalanine ammonia-lyase, partial [Brassica rapa subsp. chinensis] Length = 746 Score = 126 bits (316), Expect = 4e-27 Identities = 57/64 (89%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDPL+ CL EWNGAP Sbjct: 683 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAP 742 Query: 181 LPIC 192 +PIC Sbjct: 743 IPIC 746 >ref|XP_002862326.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297307724|gb|EFH38584.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 220 Score = 126 bits (316), Expect = 4e-27 Identities = 57/64 (89%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP+L CL EWNGAP Sbjct: 157 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMLECLNEWNGAP 216 Query: 181 LPIC 192 +PIC Sbjct: 217 IPIC 220 >gb|ABC69917.1| phenylalanine ammonia-lyase [Brassica napus] Length = 719 Score = 126 bits (316), Expect = 4e-27 Identities = 57/64 (89%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDPL+ CL EWNGAP Sbjct: 656 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPLMECLSEWNGAP 715 Query: 181 LPIC 192 +PIC Sbjct: 716 IPIC 719 >gb|AAC18871.1| phenylalanine ammonia lyase [Arabidopsis thaliana] Length = 717 Score = 125 bits (315), Expect = 5e-27 Identities = 56/64 (87%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKV SPGEEFDKVFTA+CEGK+IDPL++CLKEWNGAP Sbjct: 654 KECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAP 713 Query: 181 LPIC 192 +PIC Sbjct: 714 IPIC 717 >ref|NP_190894.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana] gi|21264489|sp|P45724.2|PAL2_ARATH RecName: Full=Phenylalanine ammonia-lyase 2 gi|13605819|gb|AAK32895.1|AF367308_1 AT3g53260/T4D2_190 [Arabidopsis thaliana] gi|6630746|emb|CAB64229.1| phenylalanine ammonia-lyase [Arabidopsis thaliana] gi|22137160|gb|AAM91425.1| AT3g53260/T4D2_190 [Arabidopsis thaliana] gi|32140423|gb|AAP59439.1| phenylalanine ammonia lyase [Arabidopsis thaliana] gi|332645534|gb|AEE79055.1| phenylalanine ammonia-lyase 2 [Arabidopsis thaliana] Length = 717 Score = 125 bits (315), Expect = 5e-27 Identities = 56/64 (87%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKV SPGEEFDKVFTA+CEGK+IDPL++CLKEWNGAP Sbjct: 654 KECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAP 713 Query: 181 LPIC 192 +PIC Sbjct: 714 IPIC 717 >dbj|BAH20339.1| AT3G53260 [Arabidopsis thaliana] Length = 579 Score = 125 bits (315), Expect = 5e-27 Identities = 56/64 (87%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKV SPGEEFDKVFTA+CEGK+IDPL++CLKEWNGAP Sbjct: 516 KECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAP 575 Query: 181 LPIC 192 +PIC Sbjct: 576 IPIC 579 >gb|AAM12956.1| phenylalanine ammonia-lyase [Arabidopsis thaliana] gi|23197654|gb|AAN15354.1| phenylalanine ammonia-lyase [Arabidopsis thaliana] Length = 717 Score = 125 bits (315), Expect = 5e-27 Identities = 56/64 (87%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKV SPGEEFDKVFTA+CEGK+IDPL++CLKEWNGAP Sbjct: 654 KECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAP 713 Query: 181 LPIC 192 +PIC Sbjct: 714 IPIC 717 >gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta] Length = 315 Score = 125 bits (315), Expect = 5e-27 Identities = 55/64 (85%), Positives = 62/64 (96%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLY+FVREE+ TGLLTGEKV SPGEEFDKVFTA+C+GK+IDP+L+CLKEWNGAP Sbjct: 252 KECRSYPLYKFVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAP 311 Query: 181 LPIC 192 LPIC Sbjct: 312 LPIC 315 >gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus] Length = 715 Score = 125 bits (314), Expect = 6e-27 Identities = 55/64 (85%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 K+CRSYPLY+FVREE+ TGLLTGEKV SPGEEFDKVFTAIC+GK+IDP+L CLKEWNGAP Sbjct: 652 KDCRSYPLYKFVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAP 711 Query: 181 LPIC 192 LPIC Sbjct: 712 LPIC 715 >gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana] Length = 725 Score = 125 bits (314), Expect = 6e-27 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP++ CL EWNGAP Sbjct: 662 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAP 721 Query: 181 LPIC 192 +PIC Sbjct: 722 IPIC 725 >ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana] gi|76803811|sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 gi|15028193|gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana] gi|19310727|gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana] gi|20197947|gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana] gi|28058755|gb|AAO29949.1| Unknown protein [Arabidopsis thaliana] gi|32140421|gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana] gi|330254247|gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana] gi|429840554|gb|AGA15805.1| PAL1 [Expression vector pUDE172] Length = 725 Score = 125 bits (314), Expect = 6e-27 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP++ CL EWNGAP Sbjct: 662 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAP 721 Query: 181 LPIC 192 +PIC Sbjct: 722 IPIC 725 >ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. lyrata] gi|297327327|gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. lyrata] Length = 725 Score = 125 bits (314), Expect = 6e-27 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP++ CL EWNGAP Sbjct: 662 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAP 721 Query: 181 LPIC 192 +PIC Sbjct: 722 IPIC 725 >ref|XP_002877909.1| phenylalanine ammonia-lyase 2 [Arabidopsis lyrata subsp. lyrata] gi|297323747|gb|EFH54168.1| phenylalanine ammonia-lyase 2 [Arabidopsis lyrata subsp. lyrata] Length = 717 Score = 125 bits (314), Expect = 6e-27 Identities = 56/64 (87%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKV SPGEEFDKVFTA+CEGK+IDPL++CLKEWNGAP Sbjct: 654 KECRSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAP 713 Query: 181 LPIC 192 +PIC Sbjct: 714 IPIC 717 >dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana] Length = 357 Score = 125 bits (314), Expect = 6e-27 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP++ CL EWNGAP Sbjct: 294 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAP 353 Query: 181 LPIC 192 +PIC Sbjct: 354 IPIC 357 >dbj|BAD95069.1| phenylalanine ammonia lyase [Arabidopsis thaliana] Length = 120 Score = 125 bits (314), Expect = 6e-27 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLYRFVREEL T LLTGEKVTSPGEEFDKVFTAICEGK+IDP++ CL EWNGAP Sbjct: 57 KECRSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAP 116 Query: 181 LPIC 192 +PIC Sbjct: 117 IPIC 120 >gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta] Length = 712 Score = 125 bits (314), Expect = 6e-27 Identities = 54/64 (84%), Positives = 62/64 (96%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLY+FVREE+ TGLLTGEK+ SPGEEFDKVFTA+C+GK+IDP+L+CLKEWNGAP Sbjct: 649 KECRSYPLYKFVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAP 708 Query: 181 LPIC 192 LPIC Sbjct: 709 LPIC 712 >sp|P45727.1|PALY_PERAE RecName: Full=Phenylalanine ammonia-lyase gi|563243|gb|AAA51873.1| phenylalanine ammonia lyase [Persea americana] Length = 620 Score = 125 bits (313), Expect = 8e-27 Identities = 55/64 (85%), Positives = 61/64 (95%) Frame = +1 Query: 1 KECRSYPLYRFVREELKTGLLTGEKVTSPGEEFDKVFTAICEGKMIDPLLNCLKEWNGAP 180 KECRSYPLY+FVREELKT LLTGEKV SPGEEFDKVF+AIC+GK+IDPLL CL+EWNGAP Sbjct: 557 KECRSYPLYKFVREELKTSLLTGEKVRSPGEEFDKVFSAICQGKVIDPLLECLREWNGAP 616 Query: 181 LPIC 192 +PIC Sbjct: 617 IPIC 620