BLASTX nr result
ID: Papaver27_contig00023225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00023225 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309051.1| hypothetical protein POPTR_0006s08460g [Popu... 56 5e-06 >ref|XP_002309051.1| hypothetical protein POPTR_0006s08460g [Populus trichocarpa] gi|222855027|gb|EEE92574.1| hypothetical protein POPTR_0006s08460g [Populus trichocarpa] Length = 215 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 218 LLLMAAQQEGGWPLGLQPLNVRVGLVRNRDFSG 316 +++ A QQE GWPLGL+PLN RVGLVRNRDF+G Sbjct: 1 MVMEAQQQEDGWPLGLRPLNARVGLVRNRDFNG 33